KEGG   Rattus norvegicus (rat): 24162
Entry
24162             CDS       T01003                                 

Gene name
Acp2
Definition
(RefSeq) lysosomal acid phosphatase isoform 1x precursor
  KO
K14410  lysosomal acid phosphatase [EC:3.1.3.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00740  Riboflavin metabolism
rno01100  Metabolic pathways
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    24162 (Acp2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    24162 (Acp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     24162 (Acp2)
SSDB
Motif
Pfam: His_Phos_2
Other DBs
NCBI-GeneID: 24162
NCBI-ProteinID: NP_001344000
RGD: 2021
Ensembl: ENSRNOG00000013594
Position
3
AA seq 434 aa
MAGRQSGWSQAALLQFLLGMCLMVMPPIQARSLRFVTLLYRHGDRSPVKAYPKDPYQEEK
WPQGFGQLTKEGMLQHWELGQALRQRYHGFLNASYHRQEVYVRSTDFDRTLMSAEANLAG
LFPPTEVQHFNPNISWQPIPVHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNMSI
QNAQFLDMVANETGLMNLTLETIWNVYDTLFCEQTHGLLLPPWASPQTVQRLSQLKDFSF
LFLFGIHDQVQKARLQGGVLLAQILKNLTLMATTSQFPKLLVYSAHDTTLVALQMALNVY
NGKQAPYASCHIFELYQEDNGNFSVEMYFRNDSKKAPWPLTLPGCPHRCPLQDFLRLTEP
VIPKDWQKECQLASDTADTEVIVALAVCGSILFLLIVLLLTVLFRMQAQPPGYHHVADRE
DHAXQPLSPLPSAS
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggccggcagacagtctggttggagccaggcggctcttctccagttccttcttggcatg
tgcctaatggtgatgccacccatacaagcccggagtctgcgctttgttaccttgctgtat
cgacacggagatcggtcaccagtgaaggcatatcctaaggacccctatcaggaagagaaa
tggccccagggatttggtcagctaaccaaggaagggatgctacagcattgggagctgggc
caggccctgcggcaacgctaccatggctttctgaacgcctcttaccacaggcaagaggtt
tacgtgcgaagcacagactttgaccgtactctcatgagtgcagaggccaacctggccgga
ctcttccctcccactgaagttcagcacttcaacccgaacatttcatggcagcctatccct
gtccacaccgtgcccattactgaagacaggttgctgaagtttcctttgggtccatgtccc
cgttatgagcagttgcagaacgagactcggcagacaccagagtatcagaacatgagtatt
cagaatgcacaatttctggacatggtggccaatgagacagggcttatgaacttgacccta
gagaccatctggaatgtgtatgacacactcttttgtgagcaaacacatgggctgctcctg
ccaccctgggcctctccccaaaccgtgcagcgtctgagccagctaaaggacttcagcttc
ctcttcctcttcgggatccacgatcaagtacagaaggcccggcttcaggggggagttctg
ctggctcaaatattgaagaatctgaccctaatggcaactacctctcaattccctaagctt
ctggtttattctgcgcatgacactaccctggttgctctgcaaatggcactgaatgtctac
aatggtaaacaagccccctatgcttcctgccacatatttgaactgtaccaggaagataat
gggaatttctcagtcgagatgtactttcggaatgacagtaagaaggcaccctggccactg
accctgcctggctgtcctcaccgttgcccactgcaggacttccttcgcctcacagaacct
gtcatacccaaggactggcagaaggagtgccagctagcaagcgatactgcagacacagag
gtgattgtggcactggctgtctgtggctccatcctcttccttctaatagtgttgctcctc
actgtcctcttccggatgcaggcccagcctcctggctaccaccatgttgcagacagggaa
gaccatgcttgacaaccactcagtccccttccctctgcctcctag

DBGET integrated database retrieval system