KEGG   Rattus norvegicus (rat): 24165Help
Entry
24165             CDS       T01003                                 

Gene name
Ada
Definition
(RefSeq) adenosine deaminase
  KO
K01488  adenosine deaminase [EC:3.5.4.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    24165 (Ada)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    24165 (Ada)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.4  adenosine deaminase
     24165 (Ada)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: A_deaminase
Motif
Other DBs
NCBI-GeneID: 24165
NCBI-ProteinID: NP_569083
RGD: 2031
Ensembl: ENSRNOG00000010265
UniProt: Q920P6
Position
3q42
AA seq 352 aa AA seqDB search
MAQTPAFNKPKVELHVHLDGAIKPETILYYGKKRGIDLPADTVEGLRNIIGMDKPLSLPD
FLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVDPIPWNQA
EGDLTPDEVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSPEVLELCKKYHQKTVVAM
DLAGDETIEGSSLFPGHVEAYEGAVKDGIHRTVHAGEVGSAEVVREAVDILKTERVGHGY
HTIEDEALYNRLLKENMHFEVCPWSSYLTGAWNPKTTHAVVRFKDDQANYSLNSDDPLIF
KSTVDTDYQMVKKDMGFTEEEFKRLNINAAKSSFLPEDEKKELLERLYKEYQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggcccagacgcccgcattcaacaagcccaaagtagagctgcacgtccacctggatgga
gccatcaagccagaaaccatcttgtactatggcaagaagagaggaatcgacctcccggca
gatacagtggagggactacgcaacattatcggcatggacaagcctctctcgctcccagac
ttcctggccaagttcgattactacatgcctgccatcgcgggctgcagggaggccatcaag
agaatcgcctatgaatttgtggagatgaaggcaaaggaaggcgtggtgtacgtggaagtt
cgctacagcccacacctgctggccaactccaaagtggacccaatcccctggaaccaggcc
gaaggagacctcacccctgatgaggttgtggatcttgtaaaccagggcctgcaggaggga
gagcaagcattcggcatcaaggtccggtccatcttgtgctgcatgcgccaccagcccagc
tggtcccctgaggtgttggagctgtgtaagaagtaccatcagaagaccgtggtggctatg
gacttggctggggatgagaccattgaaggaagcagccttttcccgggccacgtggaagcc
tacgagggtgcagtgaaggatggcattcaccggactgtccatgctggagaggtgggctct
gctgaggtggtgcgagaggctgtggacatactcaagacagagagagtggggcacggctac
cacacaatagaggatgaagccctctacaacaggctactgaaagaaaacatgcactttgag
gtctgcccctggtccagctacctcactggcgcctggaatcccaaaacgacgcatgcagtt
gttcgcttcaaagatgatcaggccaactactccctcaactcggacgaccccctcatcttc
aagtccaccgtggacactgactaccagatggtgaaaaaagacatgggcttcactgaagag
gagttcaagagactgaacatcaatgcggcgaagtcaagcttcctcccagaggacgagaag
aaggaacttctggaacggctctacaaggaataccaatag

DBGET integrated database retrieval system