KEGG   Rattus norvegicus (rat): 24166
Entry
24166             CDS       T01003                                 

Gene name
Adcyap1
Definition
(RefSeq) pituitary adenylate cyclase-activating polypeptide precursor
  KO
K05262  pituitary adenylate cyclase-activating polypeptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04911  Insulin secretion
rno04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24166 (Adcyap1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24166 (Adcyap1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24166 (Adcyap1)
   04924 Renin secretion
    24166 (Adcyap1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24166 (Adcyap1)
SSDB
Motif
Pfam: Hormone_2 Tricorn_C1
Other DBs
NCBI-GeneID: 24166
NCBI-ProteinID: NP_058685
RGD: 2037
Ensembl: ENSRNOG00000049882
UniProt: P13589
Position
9
AA seq 175 aa
MTMCSGARLALLVYGIIMHNSVSCSPAAGLSFPGIRPEEEAYDQDGNPLQDFYDWDPPGA
GSPASALRDAYALYYPADRRDVAHEILNEAYRKVLDQLSARKYLQSMVARGMGENLAAAA
VDDRAPLTKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL
NT seq 528 nt   +upstreamnt  +downstreamnt
atgaccatgtgtagcggagcaaggttggccctgttggtctacgggataataatgcataac
agcgtctcctgttcacctgccgccggactcagcttccctgggatcagaccagaagaagag
gcttacgatcaggacggaaacccgctgcaagacttctacgactgggaccctccgggcgca
gggagccccgcctccgcgctgcgtgacgcctacgccctttactacccagccgacaggaga
gatgtcgcccacgaaatccttaacgaagcctaccgcaaagtcttggaccagctgtccgcc
aggaagtacctgcagtccatggtggccaggggcatgggcgagaacctcgccgccgccgcg
gtggacgaccgggcaccccttaccaaacgccactcggacggcatcttcacagacagctat
agccgctaccgaaaacaaatggctgtcaagaaatacttggcggccgtgctagggaaaagg
tataaacagagggttaaaaacaaaggacgccgaatagcgtacttgtag

DBGET integrated database retrieval system