KEGG   Rattus norvegicus (rat): 24167Help
Entry
24167             CDS       T01003                                 

Gene name
Adcyap1r1, PAC1-R, PACAP-R1, PACAP-R1A, PACAPR1, PACAPR1A
Definition
(RefSeq) adenylate cyclase activating polypeptide 1 receptor type 1
  KO
K04587  pituitary adenylate cyclase-activating polypeptide type I receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04713  Circadian entrainment
rno04911  Insulin secretion
rno04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24167 (Adcyap1r1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24167 (Adcyap1r1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24167 (Adcyap1r1)
   04924 Renin secretion
    24167 (Adcyap1r1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24167 (Adcyap1r1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24167 (Adcyap1r1)
G protein-coupled receptors [BR:rno04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    24167 (Adcyap1r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM Insulin_TMD Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 24167
NCBI-ProteinID: NP_001257508
RGD: 2038
Ensembl: ENSRNOG00000012098
UniProt: P32215
Position
4q24
AA seq 523 aa AA seqDB search
MARVLQLSLTALLLPVAIAMHSDCIFKKEQAMCLERIQRANDLMGLNESSPGCPGMWDNI
TCWKPAQVGEMVLVSCPEVFRIFNPDQVWMTETIGDSGFADSNSLEITDMGVVGRNCTED
GWSEPFPHYFDACGFDDYEPESGDQDYYYLSVKALYTVGYSTSLATLTTAMVILCRFRKL
HCTRNFIHMNLFVSFMLRAISVFIKDWILYAEQDSSHCFVSTVECKAVMVFFHYCVVSNY
FWLFIEGLYLFTLLVETFFPERRYFYWYTIIGWGTPTVCVTVWAVLRLYFDDAGCWDMND
STALWWVIKGPVVGSIMVNFVLFIGIIIILVQKLQSPDMGGNESSIYLTNLRLRVPKKTR
EDPLPVPSDQHSPPFLSCVQKCYCKPQRAQQHSCKMSELSTITLRLARSTLLLIPLFGIH
YTVFAFSPENVSKRERLVFELGLGSFQGFVVAVLYCFLNGEVQAEIKRKWRSWKVNRYFT
MDFKHRHPSLASSGVNGGTQLSILSKSSSQLRMSSLPADNLAT
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggccagagtcctgcagctctccctgactgctctcctgctgcctgtggctattgctatg
cactctgactgcatcttcaagaaggagcaagccatgtgcctggagaggatccagagggcc
aacgacctgatgggactaaacgagtcttccccaggttgccctggcatgtgggacaatatc
acatgttggaagccagctcaagtaggtgagatggtccttgtaagctgccctgaggtcttc
cggatcttcaacccggaccaagtctggatgacagaaaccataggagattctggttttgcc
gatagtaattccttggagatcacagacatgggggtcgtgggccggaactgcacagaggac
ggctggtcggagcccttcccccactacttcgatgcttgtgggtttgatgattatgagcct
gagtctggagatcaggattattactacctgtcggtgaaggctctctacacagtcggctac
agcacttccctcgccaccctcactactgccatggtcatcttgtgccgcttccggaagctg
cattgcactcgcaacttcatccacatgaacctgtttgtatccttcatgctgagggctatc
tccgtcttcatcaaggactggatcttgtacgccgagcaggacagcagtcactgcttcgtt
tccaccgtggagtgcaaagctgtcatggttttcttccactactgcgtggtgtccaactac
ttctggctgttcattgaaggcctgtacctctttacactgctggtggagaccttcttccct
gagaggagatatttctactggtacaccatcatcggctgggggacacctactgtgtgtgta
acagtgtgggctgtgctgaggctctattttgatgatgcaggatgctgggatatgaatgac
agcacagctctgtggtgggtgatcaaaggccccgtggttggctctataatggttaacttt
gtgcttttcatcggcatcatcatcatccttgtacagaagctgcagtccccagacatggga
ggcaacgagtccagcatctacttaacaaatttaagactgagagtccccaagaaaacccga
gaggaccccctgcctgtgccctcagaccagcattcaccccctttcctcagctgcgtgcag
aaatgctactgcaagccacagcgggctcagcagcactcttgcaagatgtcagaactatcc
accattactctacggctggcccgctccaccctactgctcatcccactcttcggaatccac
tacacagtattcgccttctctccagagaacgtcagcaagagggaaagacttgtgtttgag
cttgggctgggctccttccagggctttgtggtggctgtactctactgcttcttgaatggg
gaggtacaggcagagattaagaggaaatggaggagctggaaggtgaaccgttacttcact
atggacttcaagcaccggcacccgtccctggccagcagtggagtaaatgggggaacccag
ctgtccatcctgagcaagagcagctcccagctccgcatgtccagcctcccggccgacaac
ttggccacctga

DBGET integrated database retrieval system