KEGG   Rattus norvegicus (rat): 24170Help
Entry
24170             CDS       T01003                                 

Gene name
Add1
Definition
(RefSeq) adducin 1
  KO
K18622  adducin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24170 (Add1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     24170 (Add1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 24170
NCBI-ProteinID: NP_058686
RGD: 2041
Ensembl: ENSRNOG00000013039
UniProt: Q63028
Position
14q21
AA seq 735 aa AA seqDB search
MNGDTRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSM
ILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTASVPNVYPAAPQGGMAALNMS
LGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHF
LIVPFGLLYSEVTASSLVKVNLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDAKCIVHI
HTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEEEKILIQKNLGPKSKVLILR
NHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLDPGKYKAKSRSPGTPA
GEGSGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALRERSKKYSDVEVPASVTGHS
FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDDASEEGQNGSSPKSKTKWTKEDGHRT
STSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVMMDRSLVQGELVT
ASKAIIEKEYQPHVIVSTTGPNPFNTLTDRELEEYRREVERKQKGSEENLDETREQKEKS
PPDQSAVPNTPPSTPVKLEGGLPQEPTSRDGSDATTSKPTPPDLSPDEPSEALAFPTVAE
EAHASPDTTQPLAEADPEPASASAPGAEEVASPATEEGSPMDPGSDGSPGKSPSKKKKKF
RTPSFLKKSKKKSDS
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgacacgcgggccgcagtggtgacctcaccacctccaaccacagcccctcac
aaggagaggtactttgacagagtcgatgagaacaatccagaatatttgcgggagaggaac
atggcaccagaccttcgtcaggacttcaatatgatggagcagaagaagagggtgtctatg
attctgcagagtcccgccttctgtgaagagctggagtctatgatacaggagcagtttaag
aaggggaagaaccctacaggcctgttggcattacagcagattgcggatttcatgacggcg
agtgtgcccaatgtctacccggcagctccacaaggaggaatggccgccctgaacatgagt
cttggtatggttactcctgtgaatgaccttagaggatctgattctattgcatatgacaag
ggggagaagttactgcgatgtaagctggcagcattttacagactagcagacctctttggc
tggtctcagcttatctacaatcacatcacaaccagagtgaactctgagcaggagcacttc
ctcatcgtgcctttcggacttctctacagtgaagtgactgcgtccagcctggttaaggtc
aatctacaaggagacatagtagaccgcggaagtactaacctgggagtcaaccaggccggc
ttcaccttgcactcggccatttatgctgcacgaccagatgccaagtgcattgtgcacatt
cacacaccagcaggggctgcggtctctgcaatgaagtgtgggctcttgcctatttccccg
gaggcgctttcccttggagaggttgcttatcatgactatcatggcattctggttgatgaa
gaggaaaaaattttgattcagaagaatctgggccctaaaagcaaggttctcattctccgg
aatcacgggctcgtgtcagttggagagagtgtggaggaggccttctattatatccacaac
cttgtggttgcatgtgagatccaggttcgaactctggcaagtgctggaggaccagacaac
ttagttctgctggatcctgggaagtacaaagccaaatcccgttctccagggactccagca
ggggaaggctctggatcacctcccaagtggcagattggggagcaggaatttgaagctctt
atgcggatgctcgataatctgggctacagaactggctacccctatcgataccctgctctg
agagagagatctaaaaagtacagcgatgtggaagtccctgccagtgtcaccggccactcc
tttgctagtgacggcgattcgggcacttgctcgccgctcagacacagttttcagaagcag
cagcgagagaagacaagatggctgaactctggccggggtgatgacgcttctgaggagggg
cagaacggaagcagtcccaagtcgaagactaagtggactaaagaggatggacatagaact
tccacctctgctgtccctaacctgtttgttccattgaacactaacccaaaagaggtccag
gagatgaggaacaagattcgagagcagaacttacaggacattaagacggcaggacctcag
tcgcaggttttgtgtggtgtgatgatggacagaagccttgtccagggggagctcgtgacg
gcctccaaagccatcattgagaaggaataccagcctcatgtaattgtgagcaccacaggt
cccaaccccttcaacacgctcacagaccgtgaactagaggaataccgccgagaggtggag
cggaagcagaagggctctgaagagaacctggacgagacaagagagcagaaagagaagagt
cctccagaccagtcagctgttcccaacactccgcccagcactcccgtcaagcttgaagga
ggccttccccaggagccgacatccagggatggcagcgatgccaccacctccaagccgact
ccccctgacctctcccctgatgagccttcagaagcacttgccttcccaacagtggcagag
gaagcccatgcttccccagacaccactcagccccttgctgaggctgaccctgagccagcc
tcagcctcagctccaggagctgaagaggtagcctcccctgccactgaggaggggtctccc
atggaccctggcagcgatgggtctccaggcaagtccccatccaagaagaagaagaagttc
cgcaccccgtccttcctgaagaagagcaagaagaagagtgactcctga

DBGET integrated database retrieval system