KEGG   Rattus norvegicus (rat): 24174Help
Entry
24174             CDS       T01003                                 

Gene name
Adra2b
Definition
(RefSeq) adrenoceptor alpha 2B
  KO
K04139  adrenergic receptor alpha-2B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    24174 (Adra2b)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24174 (Adra2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24174 (Adra2b)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    24174 (Adra2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv
Motif
Other DBs
NCBI-GeneID: 24174
NCBI-ProteinID: NP_612514
RGD: 2057
Ensembl: ENSRNOG00000013887
UniProt: P19328
Position
3q36
AA seq 453 aa AA seqDB search
MSGPTMDHQEPYSVQATAAIASAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLA
AADILVATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVS
RALEYNSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQRPEPRGLPQCELNQEAWYILA
SSIGSFFAPCLIMILVYLRIYVIAKRSHCRGLGAKRGSGEGESKKPQPVAGGVPTSAKVP
TLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPTWSALPRSGQGQKKGTSGATAE
EGDEEDEEEVEECEPQTLPASPASVCNPPLQQPQTSRVLATLRGQVLLGKNVGVASGQWW
RRRTQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQHCKVPHGLFQFFFWIGYC
NSSLNPVIYTVFNQDFRRAFRRILCRPWTQTGW
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccccaccatggaccatcaggagccctactcggtgcaggccaccgccgccatc
gcgtcggccatcacctttctcatccttttcaccattttcggcaatgcgctggtcattctg
gctgtgttgaccagccgctcactccgtgcaccacaaaacctgttcctggtgtcactggca
gcagccgacatcctagtggctactctcatcatccctttctctctggccaacgagctgctg
ggctactggtacttctggcgtgcgtggtgcgaggtctacctggcgctagacgtgctcttc
tgtacctcctccatcgtgcacctgtgtgccatcagcctggacaggtactgggcagtgagc
cgagcattggagtacaactccaagcgcactccgcgccgcatcaagtgcatcatcctcact
gtgtggctcattgcagctgtcatttctctaccgcccctcatctacaagggcgaccaacgc
cccgagccccgcgggctcccccagtgtgagctcaaccaggaggcctggtacatcttggct
tccagcatcggatctttttttgctccctgcctcatcatgatcctcgtctacctgcgaatc
tacgtgattgccaaacgcagccactgcagaggtctcggagccaagaggggctctggagaa
ggtgagtccaagaagccccagccggttgctgggggagtgccaacctcagctaaggtgccc
accctggtctctcctctatcttctgttggagaggccaatggacaccccaagcctccaaga
gagaaggaggagggggagacccctgaagatcctgaggccagggctttgcccccaacttgg
tctgcccttcccagatcaggccaaggccagaagaaggggactagtggggcgactgcagag
gagggagatgaagaggatgaggaagaggtggaagaatgtgaaccccaaacactgccagca
tctcctgcctcggtatgcaacccacccttgcagcagcctcagacttctcgggtactggcc
acacttcgtggccaggtgcttctgggcaagaatgtgggagttgccagtgggcagtggtgg
cgcagacggacacagctgagccgggagaagaggttcacctttgtgctggccgtggtcatt
ggagttttcgtggtctgctggtttcctttcttcttcagctacagcctgggggccatctgc
ccacagcactgcaaggtaccgcatggcctcttccagttcttcttctggatcggctactgc
aacagctctttgaaccctgtcatctacaccgtcttcaaccaggacttccgccgtgccttt
cgaaggatcctttgccggccgtggacccagactggctggtga

DBGET integrated database retrieval system