KEGG   Rattus norvegicus (rat): 24175Help
Entry
24175             CDS       T01003                                 

Gene name
Adra2c
Definition
(RefSeq) adrenoceptor alpha 2C
  KO
K04140  adrenergic receptor alpha-2C
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    24175 (Adra2c)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24175 (Adra2c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24175 (Adra2c)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    24175 (Adra2c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 24175
NCBI-ProteinID: NP_612515
RGD: 2058
Ensembl: ENSRNOG00000009299
UniProt: P22086
Position
14q21
AA seq 458 aa AA seqDB search
MASPALAAALAAAAAEGPNGSDAGEWGSGGGANASGTDWAPPPGQYSAGAVAGLAAVVGF
LIVFTVVGTVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSFYRRPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLTEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRR
GGRRREGAEGDTGSADGPGPGLAAEQGARTASRSPGPGGRLSRASSRSVEFFLSRRRRAR
SSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQLPEPLFKFFFW
IGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccccagcgctggccgcggccctggcggcggcggcggctgagggccccaacggg
agcgacgcgggcgaatggggtagcggcgggggtgccaatgcctcggggaccgactgggca
ccaccgccgggccagtactccgcaggtgctgtggcagggctggcagccgtggtgggtttc
ctcatcgttttcaccgtggtgggcaccgtgctcgtggtgatcgctgtgttgacaagccga
gcgctgcgcgccccgcagaacctcttcctggtgtctctggcctcagctgacatcctggtg
gccacactggtcatgcccttttcgctggccaatgagctcatggcctactggtactttggg
caagtgtggtgtggtgtgtacctggcactggacgtgctcttctgcacctcgtccatcgtg
cacctgtgtgccattagcctggaccgctactggtcggtgacgcaagcggtagagtacaac
ctgaagcgcacgccacgccgtgtcaaggccaccatcgtggccgtgtggctcatctcggct
gtcatctccttcccgcctctcgtctctttctaccgccggcccgacggcgccgcctacccg
cagtgcggcctcaacgatgagacctggtacatcttgtcctcctgcataggctccttcttc
gcgccctgcctcatcatgggcctggtctatgcgcgcatctaccgcgtggccaagctgcgc
acgcgtacgctcacggagaaacgcggccccgccggccccgacggcgcgtccccgaccaca
gagaatgggttgggcaaggcggcgggggagaatgggcattgcgcgcccccgcgcactgaa
gtggagccggatgagagcagcgcggcagagaggcggaggcgccggggagcgctgcgcaga
ggaggacggcggcgagagggtgccgagggggacacgggcagtgcggacggaccgggacct
gggttggcggccgaacagggtgctcggacggcgtctcggtctccaggccccggagggcgc
ctgtcgcgggccagctcgcgctccgtcgagttcttcctgtcgcgtcggcgccgggcgcgc
agcagtgtgtgccgccgcaaggtggcccaggcgcgcgagaaacgcttcaccttcgtgttg
gcggtggtcatgggcgtgttcgtactgtgctggttccccttcttcttcagctacagcctg
tatggcatctgccgtgaggcctgccagctgccagaaccgctctttaagtttttcttctgg
atcggctactgcaacagttcgctcaacccggtcatctatactgtcttcaatcaggacttc
aggcgctctttcaagcacatcctcttccgtaggaggagaaggggcttcaggcagtga

DBGET integrated database retrieval system