KEGG   Rattus norvegicus (rat): 24177
Entry
24177             CDS       T01003                                 

Gene name
Afp
Definition
(RefSeq) alpha-fetoprotein
  KO
K16144  alpha-fetoprotein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    24177 (Afp)
SSDB
Motif
Pfam: Serum_albumin VitD-bind_III YqfD
Other DBs
NCBI-GeneID: 24177
NCBI-ProteinID: NP_036625
RGD: 2065
Ensembl: ENSRNOG00000002889
UniProt: G3V6D0
Position
14p22
AA seq 611 aa
MKQPATMKWSASISFLLLLNFAEPRVLHTNEFGIESTLDSSQCPTEKNMFNVATIVVAQF
VQDATKAEVNKMSSDALAAMKENTGDGCLENQLSVFLDEICHETELSNKYGFSGCCNQSG
VERHQCLLARKKTAPDSVPPFHFPETAESCPAYEENRAMSINTFIYDVSKRNPFLYAPTI
LYLAAQYDKAVPACCKADNMEECFQTKRASMAKELREGSMLNEHVCAVIRKFGSRNLQAV
LIIKLSQKFPKANITEIRKLALDVAHIHEQCCHGNAMECLQDGESVMTHICSQQEILSSK
TAECCKLPTIELGYCIIHAENGDKPEGLTLNPSEFLGDRNFAQFSSEEKLLFMASFLHEY
SRNHPNLPVSVILKTAKSYQEILEKCSQSETPSKCQDNMEEELQKHIQESQALAKQSCDL
YQKLGPYYLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASMCCQLSEEKRSACGEGLAD
IYIGHLCLRHEANPVNSGINHCCSSSYSNRRLCITSFLRDETYVPPPFSEDKFIFHKDLC
QAQGRALQTMKQELLINLVKQKPEMTEEQHAAVTADFSGLLEKCCKDQDQEACFAKEGPK
LISKTREALGV
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgaagcagccagcaaccatgaagtggagcgcatccatttccttccttctcctgctaaat
tttgctgaacccagagtactgcacacaaatgagtttggaatagaatccacattagactct
tcccagtgcccgacagagaaaaatatgtttaacgtagctaccattgtcgttgcccagttt
gttcaggatgccacaaaggccgaagtaaacaaaatgagtagcgatgcgttggctgcaatg
aaggaaaacactggcgatgggtgtttagaaaaccagctatctgtgtttctggatgaaatt
tgccacgagacggaactctctaacaagtatggattctcaggttgctgcaaccaaagcggg
gtggaaagacaccagtgtctgctggctcgcaagaagaccgctccagactctgtcccaccc
ttccactttccagaaactgccgagagttgcccagcatatgaagaaaacagggcgatgtcc
ataaacacgttcatctacgatgtgtcgaagaggaaccccttcctgtatgctcccaccatt
ctttacttagccgctcagtatgacaaggcagttccagcatgctgcaaagctgacaacatg
gaggaatgcttccagacaaagagagcatcaatggcaaaggaattaagagaaggaagcatg
ctcaatgagcatgtgtgtgcagtaataagaaagtttggatcccggaacctccaggctgta
ctcatcattaaactaagtcaaaagtttcccaaagcaaatattactgagattcggaagctg
gccctggacgtggcccacatccacgagcagtgctgccacggcaacgcgatggagtgccta
caggatggggaaagcgtcatgacacatatatgttctcaacaagaaattctgtcgagcaaa
acagcagagtgctgcaaactacccaccatcgagctcggctattgcataattcatgccgaa
aatggcgacaaaccggaaggtttaactctgaacccaagcgagtttttgggagacagaaat
tttgcccagttttcttcagaggaaaaactcctgtttatggcaagctttcttcatgaatat
tcaagaaatcaccccaaccttcctgtctcagtcattctaaaaactgctaagtcataccag
gaaattttggagaagtgctcccagtctgaaacgccatcgaaatgccaggacaatatggaa
gaagaattgcaaaaacacatccaggagagccaggcactggccaaacaaagttgtgatctc
taccagaagttaggaccctactacttacaaaatctgttcctcattggctacacgcggaag
gctcctcagctgacctcagcagagctgatagacctgacagggaagatggtgagcattgcc
tcaatgtgctgccagctcagtgaggagaaacggtccgcctgcggtgagggactggccgac
atttacattggacacttgtgtttaagacatgaggcaaaccctgtgaactccggtatcaac
cactgctgcagttcctcgtattccaacaggaggctctgcatcaccagctttctgagggac
gaaacctacgtccctccaccattctctgaagacaaattcatcttccacaaggatctgtgc
caagctcagggccgagccctacagaccatgaaacaagagcttctcattaacctggtgaaa
caaaagcctgaaatgacagaggagcagcacgcggctgtcactgctgatttctctggcctc
ttggagaagtgctgcaaagaccaggatcaggaagcctgtttcgcaaaagagggtccaaag
ttgatttccaaaactcgtgaggctttgggggtttaa

DBGET integrated database retrieval system