KEGG   Rattus norvegicus (rat): 24179
Entry
24179             CDS       T01003                                 

Gene name
Agt
Definition
(RefSeq) angiotensinogen precursor
  KO
K09821  angiotensinogen
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04261  Adrenergic signaling in cardiomyocytes
rno04270  Vascular smooth muscle contraction
rno04614  Renin-angiotensin system
rno04924  Renin secretion
rno04925  Aldosterone synthesis and secretion
rno04927  Cortisol synthesis and secretion
rno04931  Insulin resistance
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno05200  Pathways in cancer
rno05410  Hypertrophic cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    24179 (Agt)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24179 (Agt)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    24179 (Agt)
   04614 Renin-angiotensin system
    24179 (Agt)
   04925 Aldosterone synthesis and secretion
    24179 (Agt)
   04927 Cortisol synthesis and secretion
    24179 (Agt)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24179 (Agt)
   04270 Vascular smooth muscle contraction
    24179 (Agt)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24179 (Agt)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    24179 (Agt)
   05414 Dilated cardiomyopathy
    24179 (Agt)
   05415 Diabetic cardiomyopathy
    24179 (Agt)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    24179 (Agt)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24179 (Agt)
   04934 Cushing syndrome
    24179 (Agt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24179 (Agt)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I4: serpin family
   24179 (Agt)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 24179
NCBI-ProteinID: NP_602308
RGD: 2069
Ensembl: ENSRNOG00000018445
UniProt: P01015
Structure
PDB: 
2WXZ 2WY1

Position
19
AA seq 477 aa
MTPTGAGLKATIFCILTWVSLTAGDRVYIHPFHLLYYSKSTCAQLENPSVETLPEPTFEP
VPIQAKTSPVDEKTLRDKLVLATEKLEAEDRQRAAQVAMIANFMGFRMYKMLSEARGVAS
GAVLSPPALFGTLVSFYLGSLDPTASQLQVLLGVPVKEGDCTSRLDGHKVLTALQAVQGL
LVTQGGSSSQTPLLQSTVVGLFTAPGLRLKQPFVESLGPFTPAIFPRSLDLSTDPVLAAQ
KINRFVQAVTGWKMNLPLEGVSTDSTLFFNTYVHFQGKMRGFSQLTGLHEFWVDNSTSVS
VPMLSGTGNFQHWSDAQNNFSVTRVPLGESVTLLLIQPQCASDLDRVEVLVFQHDFLTWI
KNPPPRAIRLTLPQLEIRGSYNLQDLLAQAKLSTLLGAEANLGKMGDTNPRVGEVLNSIL
LELQAGEEEQPTESAQQPGSPEVLDVTLSSPFLFAIYERDSGALHFLGRVDNPQNVV
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgactcccacgggggcaggcctgaaggccaccatcttctgcatcctgacctgggtcagc
ctgacagctggggaccgcgtatacatccacccctttcatctcctctactacagcaagagc
acctgcgcccagctggagaaccccagtgtggagacgctcccagagccaacctttgagcct
gtgcccattcaggccaagacctcccccgtggatgagaagaccctgcgagataagctcgtg
ctggccactgagaagctagaggctgaggatcggcagcgagctgcccaggtcgcgatgatt
gccaacttcatgggtttccgcatgtacaagatgctgagtgaggcaagaggtgtagccagt
ggggccgtcctctctccaccggccctctttggcaccctggtctctttctaccttggatcg
ttggatcccacggccagccagttgcaggtgctgctgggcgtccctgtgaaggagggagac
tgcacctcccggctggacggacataaggtcctcactgccctgcaggctgttcagggcttg
ctggtcacccagggtggaagcagcagccagacacccctgctacagtccaccgtggtgggc
ctcttcactgccccaggcttgcgcctaaaacagccatttgttgagagcttgggtcccttc
acccccgccatcttccctcgctctctggacttatccactgacccagttcttgctgcccag
aaaatcaacaggtttgtgcaggctgtgacagggtggaagatgaacttgccactagagggg
gtcagcacggacagcaccctatttttcaacacctacgttcacttccaagggaagatgaga
ggcttctcccagctgactgggctccatgagttctgggtggacaacagcacctcagtgtct
gtgcccatgctctcgggcactggcaacttccagcactggagtgacgcccagaacaacttc
tccgtgacacgcgtgcccctgggtgagagtgtcaccctgctgctgatccagccccagtgc
gcctcagatctcgacagggtggaggtcctcgtcttccagcacgacttcctgacttggata
aagaacccgcctcctcgggccatccgtctgaccctgccgcagctggaaattcggggatcc
tacaacctgcaggacctgctggctcaggccaagctgtctacccttttgggtgctgaggca
aatctgggcaagatgggtgacaccaacccccgagtgggagaggttctcaacagcatcctc
cttgaactccaagcaggcgaggaggagcagcccacagagtctgcccagcagcctggctca
cccgaggtgctggacgtgaccctgagcagtccgttcctgttcgccatctacgagcgggac
tcaggtgcgctgcactttctgggcagagtggataacccccaaaatgtggtgtga

DBGET integrated database retrieval system