KEGG   Rattus norvegicus (rat): 24182Help
Entry
24182             CDS       T01003                                 

Gene name
Agtr2, AT2-R, AT2R, AT<sub>2</sub>R
Definition
(RefSeq) angiotensin II receptor, type 2
  KO
K04167  angiotensin II receptor type 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04261  Adrenergic signaling in cardiomyocytes
rno04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24182 (Agtr2)
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    24182 (Agtr2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24182 (Agtr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24182 (Agtr2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Angiotensin
    24182 (Agtr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 FA_desaturase
Motif
Other DBs
NCBI-GeneID: 24182
NCBI-ProteinID: NP_036626
RGD: 2072
Ensembl: ENSRNOG00000050006
UniProt: P35351 B1WBL8
Position
Xq34
AA seq 363 aa AA seqDB search
MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFA
VNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDT
FVS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacaacttcagttttgctgccaccagcagaaacatcaccagcagtcttcctttt
gataatctcaacgcaactggcaccaatgagtccgcatttaactgctcacacaaaccggca
gataagcatttggaagcaattcctgttctctactacatgatttttgtgattggttttgct
gttaacattgttgtggtctcactgttttgttgtcaaaagggccctaaaaaggtgtccagc
atttacatcttcaatctggctgtggctgacttactccttttggcaacccttcctctctgg
gcaacctattactcttatagatatgactggctctttggacctgtgatgtgcaaagtgttt
ggttcttttctgaccctgaacatgtttgcaagcattttttttattacgtgcatgagtgtt
gataggtaccaatcggttatctacccttttctgtctcagagaaggaatccctggcaagca
tcttatgtagttccccttgtttggtgtatggcttgtctgtcctcattgccaacattttat
ttccgagatgtcagaaccattgaatacttaggtgtgaatgcttgtattatggctttccca
cctgagaaatatgctcagtggtctgctgggattgccttaatgaaaaatattcttggcttt
atcattcctttaatattcatagcaacgtgttactttggaatcagaaaacatctgctgaag
accaatagctatgggaagaacagaattacccgtgaccaagtcttgaagatggcagctgct
gttgtgttggcattcatcatttgctggcttcccttccatgttctgaccttcttggatgct
ctgacctggatgggtatcattaatagctgtgaagttatagcagtcattgacctggcactt
ccttttgccatcctcctgggattcaccaacagctgtgttaatcccttcctgtattgtttc
gttggaaaccgcttccaacagaagctccgtagtgtgtttagagttcccattacttggctc
caaggcaagagagagactatgtcttgccgaaaaagcagttctcttagagaaatggacacc
tttgtgtcttaa

DBGET integrated database retrieval system