KEGG   Rattus norvegicus (rat): 24185Help
Entry
24185             CDS       T01003                                 

Gene name
Akt1, Akt
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04213  Longevity regulating pathway - multiple species
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04371  Apelin signaling pathway
rno04380  Osteoclast differentiation
rno04510  Focal adhesion
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04620  Toll-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04630  Jak-STAT signaling pathway
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno04668  TNF signaling pathway
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04910  Insulin signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04915  Estrogen signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04920  Adipocytokine signaling pathway
rno04922  Glucagon signaling pathway
rno04923  Regulation of lipolysis in adipocytes
rno04926  Relaxin signaling pathway
rno04929  GnRH secretion
rno04931  Insulin resistance
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04973  Carbohydrate digestion and absorption
rno05135  Yersinia infection
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24185 (Akt1)
   04015 Rap1 signaling pathway
    24185 (Akt1)
   04010 MAPK signaling pathway
    24185 (Akt1)
   04012 ErbB signaling pathway
    24185 (Akt1)
   04370 VEGF signaling pathway
    24185 (Akt1)
   04371 Apelin signaling pathway
    24185 (Akt1)
   04630 Jak-STAT signaling pathway
    24185 (Akt1)
   04668 TNF signaling pathway
    24185 (Akt1)
   04066 HIF-1 signaling pathway
    24185 (Akt1)
   04068 FoxO signaling pathway
    24185 (Akt1)
   04072 Phospholipase D signaling pathway
    24185 (Akt1)
   04071 Sphingolipid signaling pathway
    24185 (Akt1)
   04024 cAMP signaling pathway
    24185 (Akt1)
   04022 cGMP-PKG signaling pathway
    24185 (Akt1)
   04151 PI3K-Akt signaling pathway
    24185 (Akt1)
   04152 AMPK signaling pathway
    24185 (Akt1)
   04150 mTOR signaling pathway
    24185 (Akt1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    24185 (Akt1)
  09143 Cell growth and death
   04210 Apoptosis
    24185 (Akt1)
   04218 Cellular senescence
    24185 (Akt1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24185 (Akt1)
   04550 Signaling pathways regulating pluripotency of stem cells
    24185 (Akt1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    24185 (Akt1)
   04620 Toll-like receptor signaling pathway
    24185 (Akt1)
   04625 C-type lectin receptor signaling pathway
    24185 (Akt1)
   04660 T cell receptor signaling pathway
    24185 (Akt1)
   04662 B cell receptor signaling pathway
    24185 (Akt1)
   04664 Fc epsilon RI signaling pathway
    24185 (Akt1)
   04666 Fc gamma R-mediated phagocytosis
    24185 (Akt1)
   04062 Chemokine signaling pathway
    24185 (Akt1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    24185 (Akt1)
   04922 Glucagon signaling pathway
    24185 (Akt1)
   04923 Regulation of lipolysis in adipocytes
    24185 (Akt1)
   04920 Adipocytokine signaling pathway
    24185 (Akt1)
   04929 GnRH secretion
    24185 (Akt1)
   04915 Estrogen signaling pathway
    24185 (Akt1)
   04914 Progesterone-mediated oocyte maturation
    24185 (Akt1)
   04917 Prolactin signaling pathway
    24185 (Akt1)
   04926 Relaxin signaling pathway
    24185 (Akt1)
   04919 Thyroid hormone signaling pathway
    24185 (Akt1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24185 (Akt1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    24185 (Akt1)
  09156 Nervous system
   04725 Cholinergic synapse
    24185 (Akt1)
   04728 Dopaminergic synapse
    24185 (Akt1)
   04722 Neurotrophin signaling pathway
    24185 (Akt1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    24185 (Akt1)
  09149 Aging
   04211 Longevity regulating pathway
    24185 (Akt1)
   04213 Longevity regulating pathway - multiple species
    24185 (Akt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24185 (Akt1)
   05205 Proteoglycans in cancer
    24185 (Akt1)
   05230 Central carbon metabolism in cancer
    24185 (Akt1)
   05231 Choline metabolism in cancer
    24185 (Akt1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24185 (Akt1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24185 (Akt1)
   05212 Pancreatic cancer
    24185 (Akt1)
   05225 Hepatocellular carcinoma
    24185 (Akt1)
   05226 Gastric cancer
    24185 (Akt1)
   05214 Glioma
    24185 (Akt1)
   05221 Acute myeloid leukemia
    24185 (Akt1)
   05220 Chronic myeloid leukemia
    24185 (Akt1)
   05218 Melanoma
    24185 (Akt1)
   05211 Renal cell carcinoma
    24185 (Akt1)
   05215 Prostate cancer
    24185 (Akt1)
   05213 Endometrial cancer
    24185 (Akt1)
   05224 Breast cancer
    24185 (Akt1)
   05222 Small cell lung cancer
    24185 (Akt1)
   05223 Non-small cell lung cancer
    24185 (Akt1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24185 (Akt1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    24185 (Akt1)
   04931 Insulin resistance
    24185 (Akt1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    24185 (Akt1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    24185 (Akt1)
   05152 Tuberculosis
    24185 (Akt1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24185 (Akt1)
   05170 Human immunodeficiency virus 1 infection
    24185 (Akt1)
   05162 Measles
    24185 (Akt1)
   05164 Influenza A
    24185 (Akt1)
   05161 Hepatitis B
    24185 (Akt1)
   05160 Hepatitis C
    24185 (Akt1)
   05168 Herpes simplex virus 1 infection
    24185 (Akt1)
   05163 Human cytomegalovirus infection
    24185 (Akt1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    24185 (Akt1)
   05169 Epstein-Barr virus infection
    24185 (Akt1)
   05165 Human papillomavirus infection
    24185 (Akt1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    24185 (Akt1)
   05142 Chagas disease (American trypanosomiasis)
    24185 (Akt1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24185 (Akt1)
   01524 Platinum drug resistance
    24185 (Akt1)
   01522 Endocrine resistance
    24185 (Akt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24185 (Akt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     24185 (Akt1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   24185 (Akt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 24185
NCBI-ProteinID: NP_150233
RGD: 2081
Ensembl: ENSRNOG00000028629
UniProt: P47196
Position
6q32
AA seq 480 aa AA seqDB search
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEETMDF
RSGSPSDNSGAEEMEVALAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtagccattgtgaaggagggctggctgcacaaacgaggggaatatattaaa
acctggcggccacgctacttcctcctcaagaatgatggcacctttattggctacaaggaa
cggcctcaggatgtggagcagcgcgagtccccactcaacaacttctcagtggcacaatgt
cagctgatgaagacagagcggccgaggcccaacaccttcatcatccgctgcctgcagtgg
accacggtcattgagcgcaccttccatgtggaaacgcctgaggagcgggaagagtggacc
accgccattcagactgtggctgatggactcaaacggcaggaggaggagacgatggacttc
cggtcaggttcacccagtgacaactcaggtgctgaggagatggaggtggccctggccaag
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaagctactgggcaagggcacc
tttgggaaggtgatcctggtgaaggagaaggccacaggtcgctactatgccatgaagatc
ctcaagaaggaggtcatcgttgccaaggatgaggttgcccacacgcttactgagaaccgt
gtcctgcagaactctaggcatcccttccttacagccctcaagtactcattccagacccac
gaccgcctctgctttgtcatggagtacgccaatggaggcgagctcttcttccacctgtct
cgtgagcgcgtgttttcagaggaccgggcccgcttctacggtgcggagattgtgtccgcc
ctggactacttgcactccgagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacatcaagataacggacttcgggctgtgcaaggagggtatc
aaggacggtgccaccatgaagacgttctgcgggacacccgagtacctggcccctgaggtg
ctggaggacaacgactatggccgtgcagtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccatgagaagctgttcgagctc
atcctaatggaggagatccgcttcccacgcacactcgggccggaggccaagtccctgctc
tcggggctgctcaagaaggaccctacacagaggctcggtgggggctccgaggacgccaag
gagatcatgcagcaccgcttctttgccaacatcgtgtggcaagatgtgtatgagaagaag
ctgagcccacctttcaagccccaggtcacctctgagaccgacaccaggtattttgatgag
gagttcacagctcagatgatcaccatcacaccgcctgatcaagatgacagcatggagtgt
gtggacagtgaacggaggccgcactttccccagttctcctactcagccagtggcacagcc
tga

DBGET integrated database retrieval system