KEGG   Rattus norvegicus (rat): 24192Help
Entry
24192             CDS       T01003                                 

Gene name
Akr1b1, ALDRED, ALR-P-I, Akr1b3, Akr1b4, Aldr1, Alr, RATALDRED
Definition
(RefSeq) aldo-keto reductase family 1 member B
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00040  Pentose and glucuronate interconversions
rno00051  Fructose and mannose metabolism
rno00052  Galactose metabolism
rno00561  Glycerolipid metabolism
rno00790  Folate biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    24192 (Akr1b1)
   00051 Fructose and mannose metabolism
    24192 (Akr1b1)
   00052 Galactose metabolism
    24192 (Akr1b1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    24192 (Akr1b1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    24192 (Akr1b1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     24192 (Akr1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 24192
NCBI-ProteinID: NP_036630
RGD: 2092
Ensembl: ENSRNOG00000009513
Vega: OTTRNOG00000001269
UniProt: P07943
Position
4q22
AA seq 316 aa AA seqDB search
MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggctagccatctggaactcaacaacggcaccaagatgcccaccctgggtctgggcacc
tggaagtctcctcctggccaggtgaccgaggctgtgaaggttgctatcgacatggggtat
cgccacattgactgcgcccaggtgtaccagaatgagaaggaggtgggggtggccctccag
gagaagctcaaggagcaggtggtgaagcgccaggatctcttcattgtcagcaagctgtgg
tgcacgttccacgaccagagcatggtgaaaggggcctgccagaagacgctgagcgacctg
cagctggactacctggacctctaccttattcactggccaactggcttcaagcctgggcct
gactatttccccctggatgcatcgggaaacgtgattcctagtgacaccgattttgtggac
acttggacggctatggagcaactagtggatgaaggtttggtaaaagcaatcggagtctcc
aacttcaaccctcttcagattgagaggatcttgaacaaacctggcttaaagtataagcct
gctgttaaccagatcgagtgccacccatacctaactcaggagaagctgattgagtactgc
cattgcaaaggcatcgtggtgactgcatacagtccccttggttctcctgacaggccctgg
gccaagcctgaggacccctctctcctggaggatcccaggatcaaggaaattgcagccaag
tacaataaaactacagcccaggtgctgatccggttccccatccaaaggaacctggtcgtg
atccccaagtctgtgacaccagcacgtattgctgagaactttaaggtctttgactttgag
ctgagcaatgaggacatggccactctactcagctacaacaggaactggagggtgtgcgcc
ttgatgagctgtgccaaacacaaggattaccccttccacgcagaagtctga

DBGET integrated database retrieval system