KEGG   Rattus norvegicus (rat): 24205
Entry
24205             CDS       T01003                                 

Gene name
Apc
Definition
(RefSeq) adenomatous polyposis coli protein
  KO
K02085  adenomatosis polyposis coli protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04810  Regulation of actin cytoskeleton
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    24205 (Apc)
   04390 Hippo signaling pathway
    24205 (Apc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    24205 (Apc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24205 (Apc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24205 (Apc)
   05206 MicroRNAs in cancer
    24205 (Apc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24205 (Apc)
   05225 Hepatocellular carcinoma
    24205 (Apc)
   05226 Gastric cancer
    24205 (Apc)
   05217 Basal cell carcinoma
    24205 (Apc)
   05213 Endometrial cancer
    24205 (Apc)
   05224 Breast cancer
    24205 (Apc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    24205 (Apc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    24205 (Apc)
   05022 Pathways of neurodegeneration - multiple diseases
    24205 (Apc)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24205 (Apc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    24205 (Apc)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    24205 (Apc)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    24205 (Apc)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     24205 (Apc)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    24205 (Apc)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     24205 (Apc)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC
Other DBs
NCBI-GeneID: 24205
NCBI-ProteinID: NP_036631
RGD: 2123
Ensembl: ENSRNOG00000020423
UniProt: P70478
Position
18
AA seq 2842 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTELETEASNMKEVLKQLQGSIEDETM
TSGQIDLLERLKEFNLDSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRA
FVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQT
DMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRVRQLLQSQAAEA
ERSSQSKHETASHEAERQLEGQGVAESNLATSGSGQSSAARVDHETAGVLSSSGTHSAPR
RLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLHG
NDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCWE
WQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVD
CEMHGLTDDHYSVTLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQ
VIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTEN
KADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVSSLIATNEDHRQILRENNCL
QTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGAVSMLKNLIHSKHKMIAMGS
AAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLSETFDNIDNLSPK
ASHRSKQRHKQNLYGDYVFDASRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGSLD
SSRSEKDRSLERERGIGLSTYHSATENPGTSSKRGLQLSATAAQIAKVMEEVSALHTSQD
DRSPASAAELHCVAEERTAARRSSASHTHPNTHNFAKSESSNRTCSMPYAKVEYKRSSND
SLNSVTSSDGYGKRGQMKPSVESYSEDDEGKFCSYGQYPADLAHKIHSANHMDDNGGELD
TPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEIKQNEQRQSRSQNTNFPVYSENT
DDKHLKFQQHFGQQECVSPYRSRGTNGSETNRMGSSHAVNQNVNQSLCQEDDYEDDKPTN
YSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLKYATDISSSQKPSFSFSKTPS
VQGTKTEHNSPSSEAASAPSSNAKRQSQLHPSSAQRNGQTPKGTACKVPSINQETMQTYC
VEDTPICFSRCSSLSSLSSAEDEIGCDQTTQEADSANTLQIAEIKENDVTRSAQDPASDV
PAVSQSTRTKPSRLQASGLASESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLV
FSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIVSPSDLPDSPGQTMPPSRSKTPPPPP
PPQPVQTKREVPKTKVPAAEQREGGPKQTAVSAAVQRVQVLPDADTLLHFATESTPDGFS
CSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETEPEQPEESNENQDKEVEKPDSEKD
LLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPPVARKPSQLPVYKLLPSQS
RLQAQKHVSFTPGDDVPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGDGVRASVQSG
EFEKRDTIPTEGRSTDEAQRGKVSSIAIPDLDGSKAEEGDILAECINSALPKGRSHKPFR
VKKIMDQVQQASMTSSGTNKNQIDTKKKKPTSPVKPMPQNTEYRTRVRKNTDSKVNVNTE
ETFSDNKDSKKQSLKNNPKDLNDKLPDNEDRVRGGFTFDSPHHYAPIEGTPYCFSRNDSL
SSLDFDDDDVDLSREKAELRKGKESKDSEAKVTCHTEPSSSQQSARKAQASTKHPVNRGP
SKPLLQEQPTFPQSSKDVPDRGAATDEKLQNFAIENTPVCFSRNSSLSSLSDVDQENNNN
EETGPVRDAEPANAQGQPGKPQASGYAPKSFHVEDTPVCFSRNSSLSSLSIDSEDDLLRE
CISSAMPKKRRPSRLKGEGEWQSPRKVGSVLAEDLTLDLKDIQRPESEHGLSPDSENFDW
KAIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGVSLGSPFHLTPDQEEKPFT
SHKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGKIRSNSEISSQMKQPLQTN
MPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPSEGPVATTSPRGTKPAVKS
ELSPITRQTSHISGSNKGPSRSGSRDSTPSRPTQQPLSRPMQSPGRNSISPGRNGISTPN
KLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQLSQQNLSKQTGLSKNASSIPRSESASKG
LNQMNNSNGSNKKVELSRMSSTKSSGSESDRSERPALVRQSTFIKEAPSPTLRRKLEESA
SFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAGGWRKLPPNLSPTIEYSDG
RPSKRHDIARSHSESPSRLPVNRAGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSES
SEKAKSEDEKHVNSVPGPRQMKENQVPTKGTWRKIKESEISPTNTVSQTTSSGAASGAES
KTLIYQMAPAVSRTEDVWVRIEDCPINNPRSGRSPTGNTPPVIDSISEKGNPSIKDSKDT
QGKQSVGSGSPVQTVGLENRLNSFIQVEAPEQKGTETKAGQGSPAPVAETGETCMAERTP
FSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPSQIPTPVGSSTKKRDSKTD
STESSGAQSPKRHSGSYLVTSV
NT seq 8529 nt   +upstreamnt  +downstreamnt
atggcagcagcctcatatgatcagttgttaaagcaagttgaggccctgaagatggagaac
tcaaatcttcgacaagagctcgaagataattccaatcaccttacagaactggaaactgag
gcatctaacatgaaggaagtacttaagcagctgcagggaagtattgaagatgagactatg
acttccggacagattgatttactagagcgccttaaagaatttaacttagatagcaatttc
cccggagtgaaactacgctcgaaaatgtccctccgatcctatggaagtcgggaaggatct
gtatcaagccgttcaggagaatgcagtcctgtccccatggggtcattcccaagaagagca
tttgtaaatggaagcagagaaagcactggatacttagaagagcttgagaaagagagatca
ttactccttgctgatcttgacaaagaagaaaaggaaaaggactggtattatgctcagctt
cagaacctcacgaaaagaatagatagcctgcccttgactgagaacttttccttacagaca
gacatgacaagacggcagctggagtatgaagcacggcagatcagggccgcaatggaggag
cagcttggcacctgccaggacatggagaaacgagcacagcgaagaatagccaggattcag
caaatagagaaggacattcttcgtgtacggcagctcttacagtcccaagcggctgaagca
gagaggtcatctcagagcaagcatgaaactgcctcccatgaagctgagcggcagcttgaa
ggtcaaggagtggcagaaagcaacttggcaacttctggtagtggccagagttcagctgca
cgtgtggatcatgaaacagccggtgttttgagttctagcggcacacactctgctcctcga
aggctgacgagtcacctgggaacgaaggtggaaatggtgtattcattgttgtccatgctt
ggtactcatgataaggacgatatgtcacgaactttgctagctatgtctagctcccaagac
agctgtatatccatgcgacagtctggatgtcttcctctcctcatccagcttttacatggc
aatgacaaagactctgtgttgttgggaaattcccggggcagtaaagaggctcgggccagg
gccagtgcagccctccacaacatcattcactcacagcctgatgacaagagaggcaggcgt
gaaatccgggtccttcatcttttggaacagatacgagcttactgcgaaacctgttgggag
tggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagctcctgtt
gagcatcagatctgccctgcggtgtgtgttctgatgaaactctcatttgatgaggagcac
agacatgcgatgaatgagcttggggggctgcaggctattgcagagttactgcaggtggac
tgtgagatgcacgggctcactgatgaccactacagtgtcactctacgacggtacgctgga
atggccttgacaaacctgacctttggagatgttgccaacaaggctacgctgtgttctatg
aaaggctgcatgagggcactcgtggcccagttaaaatccgaaagtgaagacttacagcag
gttattgcaagtgttttgcggaatttgtcttggcgagcagatgtaaatagcaaaaagacg
ttgagagaagttggaagtgtgaaagcgttgatggaatgtgctttggaagttaaaaaggaa
tcaactctcaaaagcgtcttgagtgccttatggaatctgtccgcacactgcactgagaat
aaggctgacatatgtgctgtggacggggcactggcatttctggttggcaccctcacttac
cggagccagacaaatacgttagccatcattgaaagtggaggtgggatattacggaatgtg
tccagcttgatagctaccaacgaagaccacagacaaatcctaagagagaacaactgccta
caaactttattacagcacttgaaatctcacagcttgacaatagtcagtaatgcatgtgga
actctgtggaatctctcagcgagaaatcctaaagaccaggaggctctgtgggacatgggg
gcggtgagcatgctcaagaacctcattcattccaagcacaaaatgatcgctatggggagc
gcagcagctttaaggaatctcatggcaaacagacctgcaaagtataaggatgccaacatc
atgtctcctggctcaagtttgccatcccttcacgttaggaaacaaaaagctctagaagca
gaattagacgctcagcatttatcagaaacctttgacaatattgacaatttaagtcccaag
gcatctcatcgcagtaagcagagacacaagcagaatctttatggtgactatgtctttgac
gccagtcgacatgatgacaataggtcagacaactttaacactggaaacatgactgttctt
tcaccatacttaaataccacagtattgcccagctcttcttcatcaaggggaagtttagac
agttctcgttctgagaaagacagaagtttggagagagaacgaggtattggcctcagcact
taccattcagcaacagaaaatccgggaacctcttccaaacggggtttgcagctctctgcc
actgcagcccagatagccaaagtgatggaagaagtgtccgccctccacacctcccaggac
gacagaagccccgcctctgccgctgagctccactgtgtggcggaggagaggactgcagca
cgaagaagctctgcgtcccacacacatccaaacacacacaacttcgctaagtcggaaagc
tcaaacaggacatgctccatgccttatgccaaggtggaatataagagatcttcaaatgac
agcttaaacagtgtcactagtagtgatggctatggtaaaaggggccagatgaagccctcg
gttgagtcctactcagaagatgatgaaggtaagttttgcagttatgggcagtatcctgcc
gacctagcccataagatacacagtgcaaatcatatggatgataatggtggggagctggac
acaccaataaactacagcctcaagtactcagatgagcagctgaactcaggaaggcagagc
ccctcacaaaatgaaaggtgggcaagacccaagcatgtgatagaagatgaaataaagcaa
aacgagcaaaggcaatcaagaagccagaacaccaattttcccgtctactctgagaacact
gatgacaaacacctcaagttccaacagcattttgggcaacaagagtgcgtttccccatat
aggtccaggggaaccaatggttcagaaacaaatcgaatgggttctagtcatgcagttaat
caaaatgtgaaccagtctttgtgtcaggaagacgactatgaagatgacaagcctaccaac
tacagtgaacgttattctgaggaagaacagcatgaagaagaagagagaccgacaaattac
agcataaagtataatgaagagaaacaccatgtggatcagcctattgattatagtctaaaa
tatgccactgacatatcttcatcccagaagccatcattttcattctcaaagactccatca
gtacagggcactaaaactgaacataactctccaagcagtgaggctgcatctgcaccttca
tctaacgccaaaaggcagagtcagctgcatccaagttcagcacaaagaaatggtcagact
ccaaaagggactgcctgcaaagtcccctccatcaaccaagagacaatgcagacttactgt
gtagaagacaccccaatatgtttctcaaggtgtagttccttatcatcgctatcatcagct
gaggatgaaataggctgtgatcagacaacacaggaggcagactctgcgaatactctgcaa
atagcagagataaaagagaatgatgtgacgcggtcagctcaagaccctgcgagtgacgtc
ccagccgtgtcccagagtactagaaccaagcccagcagactccaggcttccggcttagct
tcagaatccgccaggcataaagctgttgagttttcttcaggagccaagtctccctccaaa
agcggtgctcagacacccaaaagtcccccagaacactatgtccaggagacgccccttgta
ttcagcaggtgtacttctgtcagctccctggacagttttgagagtcgctccatcgccagc
tctgttcagagtgagccatgtagtggaatggtgagtgggattgtcagccccagtgacctt
ccagacagcccagggcagaccatgccaccaagcagaagcaagacccctccccctccccct
cccccacagccagtgcagaccaagagagaggtgccaaaaactaaggtgcctgctgccgag
cagagagagggtgggcctaagcagacggccgtgagtgcggctgtgcagagggtgcaggtc
ctcccggatgccgacactctgttacactttgccacagagagtactccagatgggttttct
tgttcctctagcctaagtgctctgagtctggatgagccctttatacagaaagatgtggaa
ttaagaataatgcctccagttcaggaaaacgacaatgggaatgaaactgaaccagaacag
cctgaagaatctaatgaaaaccaggataaagaggtagaaaagcctgactctgaaaaagac
ttattagatgattccgatgatgatgatattgaaatattagaagaatgtattatttcagcc
atgccaacaaagtcatcacgcaaagccaaaaagctagcccagactgcttcaaaattacct
cctcctgtggcaaggaaaccgagtcagctgcctgtgtacaaacttctgccgtcacagagc
aggctgcaggcacaaaaacatgtcagctttacaccaggggacgatgtgccccgagtgtac
tgtgtggaagggacgcctataaacttctccacagcaacatctctgagtgatctcacaata
gaatcccctccgaatgagctggctgctggagatggggttagagcaagtgtacagtcaggt
gagtttgaaaaacgagataccattcctacagagggcagaagtacagatgaggctcagaga
ggaaaagtctcctctatagctataccagacctggatggtagcaaagcagaggaaggagat
attcttgcagaatgcatcaattctgccctgcccaaaggaagaagccacaagcctttccga
gtgaaaaagataatggaccaagtccaacaggcatccatgacttcatccggaactaacaaa
aatcaaatagacactaagaaaaagaagcctacttcaccagtaaagcccatgccacaaaat
actgaatacagaactcgtgtgagaaagaatacagactcaaaagttaacgtaaatactgaa
gaaactttctcagacaataaagactcaaagaaacagagcttaaaaaacaaccccaaggac
ttgaatgacaagctaccggacaatgaggacagggtccggggaggctttactttcgattca
ccgcatcattacgcacccattgaagggactccttactgcttctcacgaaatgactctttg
agttctctagattttgatgatgacgatgttgacctctccagggaaaaggctgagttaaga
aagggcaaagaaagtaaggactccgaagccaaagttacctgccacacagaaccaagctca
agccaacagtcggctaggaaggcacaggctagtacaaaacatccagtgaacagagggccg
tctaaaccactgctgcaggaacaacccactttcccccagtcctctaaagacgtaccagac
agaggggcagcaactgacgaaaaactgcagaattttgctattgaaaatacaccggtttgc
ttttctcgaaattcttctctgagctcccttagtgacgttgaccaagaaaacaacaataac
gaagaaactggaccagtcagagacgctgagcctgccaacgcgcaaggacagccaggcaag
cctcaggcatctgggtatgcgcccaagtcctttcatgtggaagacacccctgtgtgcttc
tccagaaacagctctctcagctctctgagcattgattctgaggacgacctgttgcgagag
tgcataagctctgctatgccaaaaaagaggaggccttccagactcaagggtgagggtgag
tggcagagtcctaggaaagtgggcagcgtgttagccgaagatctgacactcgacttgaaa
gatatacagaggccagagtcagaacacggtttatcccccgattcagaaaatttcgactgg
aaagctattcaggaaggtgcaaactccatagtaagtagtctgcaccaagctgccgccgcc
gccgcgtgtctgtccagacaagcgtcgtcggactcagactccatcctgtccctgaagtcg
ggcgtctccctggggtcgccttttcaccttacacctgaccaagaggagaagccattcaca
agtcataaaggcccaagaattctcaaacctggggagaaaagcacattagaagcaaaaaaa
atagaatccgaaaacaaaggaatcaaaggtggaaaaaaggtttataaaagcttgattaca
ggaaagattcgatctaattcagaaatctccagccaaatgaaacaaccccttcagacaaac
atgccttcaatctcaagaggcaggacaatgattcacatcccgggagttcggaacagctcc
tcaagtacaagccctgtctctaaaaaaggcccacccctcaagactccagcctctaaaagc
cccagtgaaggtcctgtagctaccacttctcctcgtggaactaagccagcagtgaagtca
gagctgagccctattaccaggcaaacttcccacattagtgggtcaaataaggggccctct
aggtcagggtctagagactccactccctcgagacccacacagcagccattaagtaggccg
atgcagtcgccagggcggaactcgatctcccccggtagaaatggaataagcactcctaac
aaactctctcagctgcccagaacatcgtctcccagtactgcttcgaccaagtcctcgggg
tcggggaaaatgtcctacacatccccaggccggcagctgagccagcaaaacctcagcaaa
caaacaggcttgtccaagaacgccagcagcatccccagaagtgagtcagcatccaaagga
ctgaatcagatgaataacagcaatgggtctaataaaaaggtagaactttctagaatgtct
tcaactaagtcaagtggaagtgaatcagacaggtcagaaagacctgcattagtacgccag
tccactttcatcaaagaagccccaagcccaaccctaaggaggaaactggaggaatctgcc
tcatttgaatccctttctccatcttctagaccagattctcccaccaggtcccaggcacag
accccagttttaagcccttcccttcccgatatgtctctgtccacacatccatctgttcag
gcaggtggatggcgcaagctcccacctaacctcagccccactatagagtacagtgacgga
aggccctcaaagcggcatgatatcgcacgctcccattctgaaagtccgtccagactacca
gtcaaccgagcgggaacctggaagcgtgaacacagcaaacattcctcatcccttcctcga
gtgagcacttggagaagaactggaagctcatcttctattctttctgcttcttcagagtcc
agtgaaaaagcaaaaagtgaggatgaaaagcatgtgaactctgtgccaggacccagacaa
atgaaagaaaaccaggtacccacaaaaggaacatggaggaaaataaaggaaagtgaaatt
tctcccacaaacacggtttctcagaccacttcctcaggtgctgccagtggtgctgaatca
aagactctgatctatcagatggcacctgctgtttctagaacagaggacgtttgggtgaga
attgaggactgccccattaacaaccctagatctggaagatctcccacaggtaacaccccc
ccagtgattgacagcatttcagaaaagggaaatccaagcattaaagattcaaaagacacc
caaggaaaacaaagtgtgggcagtggcagtcctgtgcaaaccgtgggtctagaaaaccgc
ctgaactcctttattcaggtagaggccccggaacagaaaggaactgagactaaagcagga
cagggtagccctgcccctgtagcagagactggtgagacctgcatggcagagcgcacccct
ttcagttcaagtagctccagcaagcacagttctcccagtgggacggtcgctgccagagtg
acgccttttaattacaacccaagccctaggaaaagcagcgcagacagcacttcagcccgg
ccatctcagatccccactccggtgggcagcagcacaaagaagagagactcgaagactgac
agcactgaatctagtggagcccagagtcctaaacgccattctgggtcttacctcgtgacg
tctgtttaa

KEGG   Rattus norvegicus (rat): 299611
Entry
299611            CDS       T01003                                 

Gene name
Apc2
Definition
(RefSeq) adenomatous polyposis coli protein 2
  KO
K02085  adenomatosis polyposis coli protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04310  Wnt signaling pathway
rno04390  Hippo signaling pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04810  Regulation of actin cytoskeleton
rno04934  Cushing syndrome
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05165  Human papillomavirus infection
rno05200  Pathways in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05213  Endometrial cancer
rno05217  Basal cell carcinoma
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    299611 (Apc2)
   04390 Hippo signaling pathway
    299611 (Apc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    299611 (Apc2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    299611 (Apc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    299611 (Apc2)
   05206 MicroRNAs in cancer
    299611 (Apc2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    299611 (Apc2)
   05225 Hepatocellular carcinoma
    299611 (Apc2)
   05226 Gastric cancer
    299611 (Apc2)
   05217 Basal cell carcinoma
    299611 (Apc2)
   05213 Endometrial cancer
    299611 (Apc2)
   05224 Breast cancer
    299611 (Apc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    299611 (Apc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    299611 (Apc2)
   05022 Pathways of neurodegeneration - multiple diseases
    299611 (Apc2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    299611 (Apc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    299611 (Apc2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    299611 (Apc2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    299611 (Apc2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     299611 (Apc2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    299611 (Apc2)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     299611 (Apc2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm_APC_u3 Suppressor_APC Arm SAMP bZIP_1 HALZ
Other DBs
NCBI-GeneID: 299611
NCBI-ProteinID: NP_001100239
RGD: 1308256
Ensembl: ENSRNOG00000033791
UniProt: D4A205
Position
7
AA seq 2281 aa
MASSVASYEQLVRQVEALKAENTHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQTDISSLYNLKFHAPALGPEPAAQTPEGSPVHGPAPSKDSF
GELSRATIRLLEELDQERCFLLSEIEKEEKEKLWYYSQLQGLSKRLDELPHVDTQFSMQM
DLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLEAQDRVQQTEPQA
LLAVKPVAVEEQEAEVPTHPEDVTPQPGNSKVEVVFWLLSMLATRDQEDTARTLLAMSSS
PESCVAMRRSGCLPLLLQILHGTEAGSVGRTGTPGAPGAKDARMRANAALHNIVFSQPDQ
GLARKEMRVLHVLEQIRAYCETCWDWLQARDSGTESGTGDTPVPIEPQICQAACAVMKLS
FDEEYRRAMNELGGLQAVAELLQVDYEMHKMTQDPLNLALRRYAGMTLTNLTFGDVANKA
TLCARRGCMEAIVAQLASESEELHQVVSSILRNLSWRADINSKKVLREVGSMTALMECVL
RASKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYRCQGNSLAVIESGGG
ILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSPRDQEL
LWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQAAAMAVSPGTCVPSLYVRK
QRALEAELDTRHLVHALGHLEKQGLPEAETTSKKPLPPLRHLDGLVQDYASDSGCFDDDD
APSLAAAATTAEPASPAVMSMFLGGPFLQGQALARTPPARQGGLEAEKETGGEAAVAAKA
KAKLALAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCRGTEGGRR
EAGSRAHPLLRLKAAHTSLSNDSLNSGSTSDGYCTREHMTPCPLAVLTEHRDGPVCGQTR
PSRLDLDLPSRAELPARDTAATDARVRTIKLSPTYQHVPLLDGAPGAGVRPLVGLGTSPG
TRKQAWIPADSLSKVPEKLVASPLPVTSKVLQKLVAQDGPMSLSRCSSLSSLSSTGHAVP
SQVENLDDSDSSLEELEEAGPGEAELDRAWRASGSTSLPVSIPAPQRGRSRGLGVEDATP
SSSSENCVQETPLVLSRCSSVSSLGSFESRSIASSIPSDPCSALGSGTVSPSELPDSPGQ
TMPPSRSRTPPAPPGQPEASQFSLQWESYVKRFLDIADCRERCQPPSELDAGSVRFTVEK
PDENFSCASSLSALALHELYVQQDVELRLRPPACPERAVGGGGGHRRRDEATSRLDGPAP
AGSRARSAADKELEALRECLGAAMPARLRKVASALVPGRRALPVPVYMLVPAPARGDDSG
TDSAEGTPVNFSSAASLSDETLQGPSRDKPARPGDRQKPTGRAAPARQTRGHRPKAAGAG
AGKSTEHTRGANRNRAGLELPLSRPQSARSNRDGSCQTRTRGDGALQSLCLTTPTEEAVY
CFYDSDEEPPATAPPTRRASAIPRALKREKPAGRKETPTRATQPATLPVRAQPRLIVDET
PPCYSLTSSASSLSEPEASEQPACHPRVEEQGSKQDSSPRAEEELLQRCISLAMPRRRTQ
VPSSRRRKPRAVRSDIRPTELPQKCREEVPGSDPASDLDSVEWQAIQEGANSIVTWLHQA
AAKASLEASSESDSLLSLVSGLSASSTLQPSKLRKGRKPVAEAGGAWRPEKRGTTSTKGS
GSPRFPSGPEKAKGTQKTMAGESAMLRGRTVIYTASPASRAQSKGISGPCSAPKKMGTSG
TTQPETATKTPSPEQQRSRSLHRPGKISELAALSHPPRSATPPARLTKTPSSSSSQTSPA
SQSLPRRSPLATPTGGPLPGPGGSPVPKSPARALLAKQHKTQKSPVRIPFMQRPARRVPP
PLARPSPEPGSRGRAGAEGTPGARGSRLGLVRVASTRSSGSESSDRSGFRRQLTFIKESP
GLLRRRRSELSSADSTVSTSQTASPCRGRPALPAVFLCSSRCDELRASPRQPLAAQRVPQ
AKPGLAPRAPRRTSSESPSRLPVRATPGRPETVKRYASLPHISVSRRPDSAVSVPTTQAN
ATRRGSDGEARPLPRVAAPGTTWRRIKDEDVPHILRSTLPATALPLRGSSPEDSPAGTPH
RKTSDAVVQTEDVATSKTNSSTSPSLESRDPPQAPISGPVAPLGSDVDGPVLAKPPASAP
FTHEGLSVVTGGFPTSRHGSPSRAARVPPFNYVPSPMVVATMTSDSAVEKAPVTSPASLL
E
NT seq 6846 nt   +upstreamnt  +downstreamnt
atggccagctccgtggcctcgtacgagcagctggtgcgccaggtggaggccttgaaggcg
gagaacactcacttaagacaggagctgagggataactctagccatctctccaagctggag
acagagacttctggcatgaaggaggtcctgaaacaccttcagggcaagctggagcaggag
gcgagagtgctggtatcctccgggcagacagaagtgttagagcaactgaaagctcttcag
actgacatcagtagcctctataacctgaagttccatgccccggccctgggccctgagcct
gctgcccagactccagagggaagcccagtacatggccctgcaccgtccaaggacagcttc
ggagagctgagccgggccaccatccgcctgctggaagaactagaccaggagagatgcttc
ctgctgagcgagatagagaaagaggagaaggagaagctgtggtattactctcagctccag
ggcctctctaagcgcttggatgaactgccacacgtagacacgcagttttcgatgcagatg
gatctaattcggcagcagctggagttcgaagcccagcacatccgctcgttgatggaggag
cgcttcggtacctcagacgagatggtgcagcgggctcagatccgggcttcacgcctggag
cagattgacaaggagctgttggaagcccaggaccgggtgcagcagacggagccccaggcg
ctgctggcggtgaagcctgtggcagtggaggagcaggaggcagaagttcccacacaccct
gaggatgtcaccccccagcctggcaacagcaaggtggaggtcgtgttctggcttctatct
atgttggcaacgcgcgaccaggaagatactgcgcgcacgctgctcgccatgtccagctcg
ccagagagctgcgtagccatgcgccgctcgggatgtctgccactgctgctccagatcctt
catggcactgaggctgggtctgtggggcgcacaggaacccccggagcgcctggtgccaaa
gatgcacgcatgcgtgccaacgcggccctgcacaacatagtcttctcccagccggatcag
ggcctggcacgcaaggagatgcgtgtgctgcacgtgctggagcagatccgagcctactgc
gagacctgctgggactggcttcaggcgcgggacagcgggacagagagtggtacaggagac
actcctgtccctatcgagcctcagatctgccaggccgcctgtgcagtgatgaagctgtca
tttgacgaggaataccgtcgggctatgaatgagctaggggggctgcaggctgtggccgag
ctactgcaggtggattatgagatgcacaagatgacccaggatccactcaacctcgccctg
cgccgctacgctggcatgaccctcaccaacctcaccttcggagacgttgccaacaaggcc
actctgtgtgcccgccgaggctgcatggaagccattgtggcccagctggcctctgagagc
gaggagctgcatcaggttgtttccagtattctgcgtaacctgtcgtggagggcggacatc
aacagcaagaaggtgctgagggaggttggcagcatgaccgctttgatggaatgtgtgctg
cgggcctccaaggagtccactctaaagagcgtgctcagtgctctgtggaacctgtcggca
cacagcacagagaacaaggcagctatctgccaggtggatggcgcgctgggtttcctggtg
agcaccctaacataccgttgccaagggaactccctagcagtcatcgagagtggcggtggg
atcctgcgcaacgtgtcaagcctcattgccacgcgggaggactacaggcaggtgctccgt
gaccacaactgcctacagacactgctgcagcacctcacgtcgcacagcttgactatcgtg
agcaatgcctgcggcaccctttggaacctgtctgcccgcagcccccgcgaccaggaactg
ttgtgggacctgggggctgtgggcatgctacgaaacctcgtccactccaaacacaagatg
atcgccatgggtagcgctgccgctctgcggaacctgctggcccaccgaccggccaagtat
caggccgcagccatggcagtctccccaggcacctgcgtgcccagtctgtacgtccgcaag
cagagggccctggaggccgagctggacactcggcacctggtgcatgcgctcggtcacttg
gagaagcagggtctgcctgaggcagagaccacttcaaagaagcccctgccacccctccgc
cacctggacgggctggtgcaggactatgcctctgattctggctgctttgatgatgatgat
gcaccatccctggctgctgcggccaccacagctgagcccgccagcccagcagtgatgtct
atgttccttggtggtcccttccttcagggccaggcactggcccgcaccccacctgcccgc
cagggtggcctagaagctgagaaggagactggtggggaggcagctgtggctgctaaagcc
aaggccaagctagcgttggctgtggctcgcatcgaccgactggtggaggacatctctgcc
ctgcacacctcatcagacgacagcttcagtctcagctcgggggacccggggcaggaggcg
ccaagggagggccgtgcgcagtcctgctctccatgccggggcacagagggtgggcggcgt
gaggctggcagccgggcgcaccctctgctgaggctcaaggcggcccacaccagcctctcc
aacgacagcctgaacagtggtagcaccagcgatggctactgtacccgggaacacatgacg
ccttgcccactggccgtgttgaccgagcaccgcgatggcccagtatgcggacagactcgg
cccagccgactggacctagaccttcccagccgggctgagcttcctgcccgggacacagca
gccactgatgcccgagtgcgcaccattaagttatccccaacctatcagcacgtgccactg
cttgatggggccccgggggcaggtgtcagacccctggttgggcttggaacctccccgggg
actcggaaacaggcatggatacctgcagatagtttgagtaaagtccccgagaagctggtg
gcctccccactgccggtgactagcaaggtgctgcagaagctggtggcacaggatgggccg
atgtccctctccaggtgcagttccctgtcttctctgtcttccacgggccatgcagtcccc
agccaggtggagaaccttgatgacagcgattcatccctggaagagcttgaggaggctggt
cctggcgaggccgagctagacagggcgtggagagcatccgggtccacctctcttccggtg
tccatcccggccccacagcggggtcgaagtcgaggtcttggggtggaggatgctacacca
tccagttcatctgagaactgcgtccaggagacacccttggtcctgagccgctgtagctct
gtgagctccctgggcagcttcgagagccgttccatcgccagctccatcccgagcgacccc
tgcagtgcgctgggcagtggtacagtgagtcccagcgagctgccagacagccccggccag
acaatgccacccagccgcagcaggactccaccggcacctcccgggcagcccgaggccagc
cagttcagcctgcagtgggaaagttacgtgaagcgcttcctggacatcgcagactgtcgg
gaaagatgccagccgccctcggagctggacgcgggcagcgtacgcttcacggtggagaag
ccggacgagaatttctcttgtgcttccagcctcagcgcactggccctgcatgagctgtat
gtccagcaggacgtggaactgcggctgaggccaccagcctgtccagaacgtgcggtgggt
ggtggtgggggccaccgtcggagggacgaggctaccagccgcctggatggcccagcacca
gctggctctagggctcggtcagcggctgataaagaactagaggcgctgcgtgaatgtctg
ggggcagccatgccggcccggctccgcaaggtggcctcggccttggtgcctggccgccgt
gcactgccggtccccgtgtacatgttagtgcccgccccggctcggggtgatgactcgggc
acagactctgcagagggcacgcctgtcaacttttccagtgcagcctctctcagtgacgag
accttacagggaccctccagggataagccggccaggcctggggacaggcagaaacctaca
ggccgagctgctcctgccaggcagacccgtgggcaccggcccaaggcagcaggagcaggt
gctggtaagagcacagagcacacacggggggctaataggaaccgggcaggattggaacta
cccctcagccggccccagagtgctcggtccaacagggatggctcatgccagacccggacc
cgtggagacggtgccctgcagtcgctatgcctcacgacacccacagaggaagctgtgtac
tgcttctatgactctgacgaggagccaccagccacagcaccaccaactcggcgggcgtcc
gccatccctcgggctcttaaacgtgagaaacccgcaggcaggaaagagaccccaaccagg
gcgacacagcctgccacactccctgtgagggcgcagccgagactgatagtagatgagacc
ccaccctgctattccctgacttcctcggctagttccctcagcgagcctgaggcctctgaa
cagccagcctgccaccctcgagtggaggagcagggcagtaaacaagatagtagcccaagg
gcagaagaggagctcctgcagagatgtatcagtttagctatgcccaggcgccggacccag
gtacccagctcacggcgtcgcaagcccagagctgtgaggtcagacataaggcccactgag
ttaccacagaaatgccgtgaagaggttcctggttctgatccagcctctgacctagatagc
gtcgagtggcaggctatccaagagggcgcaaactccattgtcacgtggctgcatcaggca
gcggccaaagccagcctggaagcttcttctgagtctgactccctcttgtctttggtgtct
gggctgtcagcaagctccaccctccagccctccaagctcagaaaagggcgaaagccagtg
gctgaggctgggggtgcctggcgtcctgagaaacggggcacaacttccactaagggcagt
gggagtccccggtttcctagtggccctgagaaggcaaagggtacccagaaaacgatggca
ggggagtcagccatgctccggggaaggacagtgatctacactgccagccctgcttcccgg
gctcagtccaaaggtatttctggaccttgttccgcacctaagaagatggggacatctggt
accactcagccagaaactgccaccaaaacccccagccctgagcaacaacgttctcggagc
ctgcaccgaccaggcaagatctctgagttggcagccttgagccacccgcccaggagtgct
actcctccagcccgcctcaccaagaccccgtcttcaagctcttcacagacctccccggca
tcccagtccctgcctaggcggtccccactggccactccaacaggagggcctctgcctgga
cctggggggtccccggtgcccaagtcaccagcccgggctcttctggctaagcaacacaag
acccagaagtcacccgtgcgtatcccattcatgcaaaggccagccaggcgagtgccacct
ccactggccaggccatccccagagcctggctccaggggccgagctggggctgagggaact
cctggggcacgtggcagccgcctgggcctggtacgtgtggcctcaactcgctctagcggc
agtgagtcctcagaccgctccggcttcagaaggcagctgaccttcattaaggagtcccca
ggtctcctccggcgccgtagatcggagctgtcctctgcggactccacggtctccacctcc
cagaccgcttcgccctgccgcggacggcccgcactccccgctgtctttctctgctcctct
cgctgtgatgagctgcgagcgtctccacggcagcccctggcagcacagagggtcccgcag
gccaagccaggtcttgccccacgtgcgcccagacgcaccagctccgagagcccctcacgc
ctgcctgtacgggcgacccctgggcggcccgagacagtcaagaggtacgcctccctgcca
catattagtgtgtcccgcaggcccgatagcgctgtctctgtgcccaccacccaggccaat
gccactcgcaggggaagtgatggcgaggccaggccgctgcccagggtggctgcgccgggt
acgacctggcgtcgtatcaaagatgaagatgtcccccacatcctgcgcagcacactgccg
gccactgccctgcctctcaggggctcatcacccgaagacagtcctgctggaactccacac
cgcaagactagcgacgcagtggtacagacagaggatgtggccacctctaaaaccaactcc
agcacgtcgcccagcctggagagcagggatcccccacaggccccgatcagtggccctgtt
gctccactgggcagcgatgtggatggaccagtacttgccaagcctcctgcctcagcgccc
ttcacccatgagggtctgagtgttgtcacggggggctttcctactagcaggcatggctcc
cccagtagggctgcacgggttccccccttcaactacgtgcccagccctatggtagtggct
acaatgaccagtgactcagctgtggagaaagcccctgttacctctccagccagcctcctg
gagtag

DBGET integrated database retrieval system