KEGG   Rattus norvegicus (rat): 24211
Entry
24211             CDS       T01003                                 

Gene name
Atp1a1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1 precursor
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24211 (Atp1a1)
   04022 cGMP-PKG signaling pathway
    24211 (Atp1a1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24211 (Atp1a1)
   04918 Thyroid hormone synthesis
    24211 (Atp1a1)
   04919 Thyroid hormone signaling pathway
    24211 (Atp1a1)
   04925 Aldosterone synthesis and secretion
    24211 (Atp1a1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    24211 (Atp1a1)
   04261 Adrenergic signaling in cardiomyocytes
    24211 (Atp1a1)
  09154 Digestive system
   04970 Salivary secretion
    24211 (Atp1a1)
   04971 Gastric acid secretion
    24211 (Atp1a1)
   04972 Pancreatic secretion
    24211 (Atp1a1)
   04976 Bile secretion
    24211 (Atp1a1)
   04973 Carbohydrate digestion and absorption
    24211 (Atp1a1)
   04974 Protein digestion and absorption
    24211 (Atp1a1)
   04978 Mineral absorption
    24211 (Atp1a1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24211 (Atp1a1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24211 (Atp1a1)
   04964 Proximal tubule bicarbonate reclamation
    24211 (Atp1a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24211 (Atp1a1)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     24211 (Atp1a1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24211 (Atp1a1)
  Exosomal proteins of other body fluids (saliva and urine)
   24211 (Atp1a1)
  Exosomal proteins of colorectal cancer cells
   24211 (Atp1a1)
  Exosomal proteins of bladder cancer cells
   24211 (Atp1a1)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 24211
NCBI-ProteinID: NP_036636
RGD: 2167
Ensembl: ENSRNOG00000030019
UniProt: P06685
Structure
PDB: 
1BG5 1MO7 1MO8

Position
2
AA seq 1023 aa
MGKGVGRDKYEPAAVSEHGDKKSKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAILCFLAYGIRSA
TEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAEEIEHFIHLITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWFA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIEVCCGSVMEMREKYTKIVEI
PFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDEVNFPVDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVNQVNPRDA
KACVVHGSDLKDMTSEELDDILRYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIVGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPFHLLGIRETWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGAALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY
NT seq 3072 nt   +upstreamnt  +downstreamnt
atggggaagggggttggacgagacaagtatgagcccgcagctgtatcagaacatggggac
aagaagagcaagaaggcgaagaaggaaagggacatggacgaactcaagaaggaagtgtct
atggacgaccataaactcagcctggatgaactccatcgtaaatacggaacagatttgagc
cgaggcctaacacccgcaagggccgctgagatcctggctcgggatggccccaacgccctc
acgccccctcccactactcccgagtgggtcaaattctgtcggcagctgttcggtggcttc
tccatgttactgtggattggagccattctttgtttcttggcttatggcatccgaagtgct
acagaagaggaaccaccaaatgatgatctgtacctcggggtcgtgctgtctgctgtcgtc
atcataactggctgtttctcctattatcaagaagcaaaaagctccaagatcatggaatcc
ttcaagaacatggtccctcagcaagccctcgtgattcgaaatggagagaagatgagcatc
aacgcagaggatgtcgtcgttggtgatctggtggaggtgaagggcggagaccgaatccct
gctgatctcagaatcatatctgcaaatggctgcaaggtggataactcctcactcactggt
gaatcagaaccccagactcggtccccggatttcacaaacgagaaccccttggagacaagg
aacattgccttcttctcaaccaactgtgttgaaggaactgcacgtggcatcgttgtgtac
actggggatcgcaccgtgatgggcaggatcgccacccttgcttctgggctggaaggcggc
cagacccccattgctgaagaaatcgagcacttcatccacctcatcacgggtgtggccgtg
ttcctgggggtgtctttcttcattctctctctgatccttgagtacacctggctcgaggct
gtcatcttcctcattggtatcatcgtagccaacgtgccggaaggtttgctggccaccgtc
acggtatgtctgacgctcactgccaagcgcatggcgaggaagaactgcctggtgaagaac
ctggaagctgtggagaccttggggtccacatccaccatctgctccgacaagactggaact
ctgactcagaaccggatgacagtggctcacatgtggtttgacaatcaaatccatgaagct
gacaccacagagaatcagagtggggtctcctttgacaagacgtcagccacctggttcgct
ctgtccagaattgctggtctctgtaacagggcagtgtttcaggctaaccaagaaaacctg
cctatccttaagcgtgcagtagcgggagatgcttccgagtcggcgctcttaaagtgcatc
gaggtctgctgtggctccgtgatggagatgagggagaagtacaccaagatagtggagatt
cctttcaactccaccaacaagtaccagctctccattcacaagaacccaaacgcatcggag
cctaagcacctgctagtgatgaagggcgccccagaaaggatcctggaccgatgcagttct
atcctcctccacggcaaggagcagcccctggacgaagagctgaaggacgcctttcagaat
gcctacctagagctggggggccttggagagcgtgtgctaggtttctgccacctccttctg
cctgacgaacagtttcccgaaggcttccagtttgacactgatgaagtcaatttccccgtg
gataacctctgcttcgtgggtcttatctccatgattgaccctcctcgagctgctgtcccc
gatgctgtgggcaaatgccgcagcgctgggattaaggtcatcatggtcacaggagaccat
ccaatcacagccaaagccattgctaagggggtgggcattatctcagaaggtaacgagacc
gtggaagacattgctgcccgcctcaacattccagtgaaccaggtgaaccccagagatgcc
aaggcctgtgtagtacatggcagtgacttgaaggacatgacctctgaggagctggatgac
attttgcggtaccacacggagattgtctttgctaggacctctcctcaacagaagctcatc
attgtggagggctgccagcggcagggtgccatcgtggctgtcacaggggatggtgtcaat
gactctccagctttgaaaaaggcagatattggggttgccatggggattgttggctcggat
gtgtccaagcaagctgctgacatgattcttctggatgacaactttgcctccatcgtgact
ggagtagaagaaggtcgtctgatatttgataacttgaagaaatccattgcttacacccta
acaagtaacattccggaaatcacccccttcttgatatttattattgcaaacattccactg
cccctgggcaccgtgaccatcctctgcattgacttgggcactgacatggttcccgccatc
tctctggcctatgaacaggctgaaagtgacatcatgaagaggcagcccagaaatcccaaa
acggacaaacttgtgaacgagcgtctgatcagcatggcctatggacagatcggtatgatc
caggccctgggaggcttcttcacttattttgtgattctggctgagaacggtttcctgccc
tttcacctgttgggcatccgagagacctgggatgaccgctggatcaatgatgtggaggac
agctacgggcagcagtggacctacgagcagaggaagattgtggagttcacctgccacacg
gccttctttgtcagtatcgtggtagtgcagtgggctgacttggtcatctgcaagaccaga
aggaattctgtcttccagcagggaatgaagaacaagatcttaatatttggcctctttgaa
gagacagctcttgctgctttcctgtcctactgccctgggatgggtgcagcccttaggatg
tatcccctcaaacctacttggtggttctgtgccttcccctactcccttctcatcttcgtg
tatgacgaggtgcggaagctcatcatcaggcgacgccctggcggctgggtggagaaggaa
acctactactag

KEGG   Rattus norvegicus (rat): 24212
Entry
24212             CDS       T01003                                 

Gene name
Atp1a2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-2 precursor
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24212 (Atp1a2)
   04022 cGMP-PKG signaling pathway
    24212 (Atp1a2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24212 (Atp1a2)
   04918 Thyroid hormone synthesis
    24212 (Atp1a2)
   04919 Thyroid hormone signaling pathway
    24212 (Atp1a2)
   04925 Aldosterone synthesis and secretion
    24212 (Atp1a2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    24212 (Atp1a2)
   04261 Adrenergic signaling in cardiomyocytes
    24212 (Atp1a2)
  09154 Digestive system
   04970 Salivary secretion
    24212 (Atp1a2)
   04971 Gastric acid secretion
    24212 (Atp1a2)
   04972 Pancreatic secretion
    24212 (Atp1a2)
   04976 Bile secretion
    24212 (Atp1a2)
   04973 Carbohydrate digestion and absorption
    24212 (Atp1a2)
   04974 Protein digestion and absorption
    24212 (Atp1a2)
   04978 Mineral absorption
    24212 (Atp1a2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24212 (Atp1a2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24212 (Atp1a2)
   04964 Proximal tubule bicarbonate reclamation
    24212 (Atp1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24212 (Atp1a2)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     24212 (Atp1a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24212 (Atp1a2)
  Exosomal proteins of other body fluids (saliva and urine)
   24212 (Atp1a2)
  Exosomal proteins of colorectal cancer cells
   24212 (Atp1a2)
  Exosomal proteins of bladder cancer cells
   24212 (Atp1a2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Other DBs
NCBI-GeneID: 24212
NCBI-ProteinID: NP_036637
RGD: 2168
Ensembl: ENSRNOG00000007290
UniProt: P06686
Position
13
AA seq 1020 aa
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYGILAAME
DEPSNDNLYLGIVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILRDHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTTNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgggtcgtggggcagggcgtgagtactcgcctgccgccaccactgcggagaatgggggt
ggcaagaagaaacagaaagagaaggagctcgatgagctgaagaaggaggttgccatggat
gaccacaagctgtccttggatgagctgggccgaaaataccaagtggatctgtccaagggc
ctcaccaaccagcgagctcaggatattctggctagagacggacccaacgccctcactcca
ccccctacaactcctgagtgggtcaagttctgccgtcagctttttgggggcttctctatc
ctgctgtggattggggcgcttctctgcttcttagcctatggtatcctggccgccatggag
gacgaaccatccaatgacaatttatatctaggtatcgtgctagcagctgtagttatcgtc
actggctgcttctcctactaccaggaagccaaaagctccaagattatggactccttcaag
aacatggtgcctcagcaagctctggtcatccgagagggagagaagatgcagatcaatgca
gaggaggtggtcgtgggagacctggtggaagtgaagggtggagaccgtgtccccgctgac
ctccggatcatctcctcccacggttgcaaggtggataactcatccctgacaggggagtcg
gagccccagacccggtcccctgagttcacccatgagaatcccttggagacccgcaatatc
tgtttcttctctaccaactgtgtggaaggcactgccaggggcattgtgatcgccacaggt
gaccggacggtgatgggccgcatagccactcttgcctctggcctagaggtgggacagacg
ccgatagccatggagatcgagcatttcatccagctgatcacgggggtggccgtgttcctg
ggggtctccttctttgttctgtcgctcatcctgggctacagctggctggaggctgtcatc
ttcctcatcggcatcatcgtagccaacgtccccgaagggctcttggccactgttactgtg
tgcctgacgctgacagccaagcgcatggctcgcaagaactgcctggtgaagaacctggag
gcggtggagacgctgggctccacgtccaccatctgctcggacaagacaggcaccctcacc
cagaaccgcatgacggtggctcacatgtggtttgacaaccagatccatgaggctgacacc
actgaagatcagtctggggccacttttgacaagcggtccccgacgtggacagccctgtct
cggatcgctggtctctgcaatcgtgccgtcttcaaggctgggcaggagaacatctccgtg
tctaagcgggacacagctggtgacgcctctgagtcagctctgctcaagtgcatcgagttg
tcctgtggctcagtgaggaagatgagggacaggaatcccaaggtggcagaaattcccttc
aactctaccaacaaatatcagctttccatccatgagagggaagacagcccccagagccat
gtgctggtgatgaaaggtgccccggagcgcatcctggaccgatgctctaccatcctggta
cagggcaaggagatccctcttgacaaggagatgcaagatgcctttcaaaacgcctacatg
gagctgggaggactcggggagcgagtgctgggcttctgtcagctgaacctgccttctgga
aagtttcctcggggcttcaaatttgacacggatgagctgaactttcccacagagaagctc
tgctttgtggggctcatgtctatgattgatccccccagagcagctgtgccagatgctgtg
ggcaagtgcagaagtgcaggcatcaaggtgatcatggtgactggggatcaccctatcaca
gccaaggccattgccaaaggtgtgggcatcatatcagagggtaacgagactgtggaagac
attgcagccaggctcaacattcctgtgagtcaagtcaatcccagagaagccaaggcatgt
gtagtgcacggctcagacctgaaggacatgacttcagagcagctggatgagatcctcagg
gaccacacggagatcgtgtttgcccggacctcccctcagcagaagctcatcattgtggag
ggctgtcagaggcagggagccatcgtggcagtgactggtgacggggtgaacgactccccc
gcgctgaagaaggctgacattggcattgccatgggcatctctggctctgatgtctctaag
caggcagctgacatgatccttctcgacgacaactttgcctccattgtgacgggcgtggag
gaggggcgcctgatctttgacaacctgaagaagtccatcgcgtacaccctgaccagcaac
atccctgagatcacccccttcctgctgttcatcattgccaacatcccccttcccctgggc
accgtgaccatcctgtgcatcgacctgggcacagacatggttcctgccatctcattagca
tacgaagcggctgagagcgacatcatgaagaggcagccacggaactcccagacggacaag
ctggtgaacgagaggcttatcagcatggcttacggacagatcggcatgatccaggctctg
ggcggcttcttcacctactttgtaatactggcagagaacggcttcctgccatcgaggctg
cttgggatccgccttgactgggatgatcggactaccaacgacctggaggacagctatgga
caagagtggacctatgagcagcggaaggtggtggagttcacatgccacacggccttcttt
gccagcatcgtggttgtgcagtgggctgacctcatcatttgcaagacccggcgcaactcg
gtgttccagcagggcatgaagaacaagatcctgatttttgggctgctagaagagacggct
ctggctgccttcctgtcttactgcccgggtatgggggtggccctccgaatgtacccactc
aaggtcacgtggtggttctgtgcctttccctacagtctcctcatcttcatctatgatgaa
gtccgaaagctcatcctgcggcggtaccctgggggctgggtggagaaggagacgtactac
tga

KEGG   Rattus norvegicus (rat): 24213
Entry
24213             CDS       T01003                                 

Gene name
Atp1a3
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-3
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24213 (Atp1a3)
   04022 cGMP-PKG signaling pathway
    24213 (Atp1a3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24213 (Atp1a3)
   04918 Thyroid hormone synthesis
    24213 (Atp1a3)
   04919 Thyroid hormone signaling pathway
    24213 (Atp1a3)
   04925 Aldosterone synthesis and secretion
    24213 (Atp1a3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    24213 (Atp1a3)
   04261 Adrenergic signaling in cardiomyocytes
    24213 (Atp1a3)
  09154 Digestive system
   04970 Salivary secretion
    24213 (Atp1a3)
   04971 Gastric acid secretion
    24213 (Atp1a3)
   04972 Pancreatic secretion
    24213 (Atp1a3)
   04976 Bile secretion
    24213 (Atp1a3)
   04973 Carbohydrate digestion and absorption
    24213 (Atp1a3)
   04974 Protein digestion and absorption
    24213 (Atp1a3)
   04978 Mineral absorption
    24213 (Atp1a3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24213 (Atp1a3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24213 (Atp1a3)
   04964 Proximal tubule bicarbonate reclamation
    24213 (Atp1a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24213 (Atp1a3)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     24213 (Atp1a3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24213 (Atp1a3)
  Exosomal proteins of other body fluids (saliva and urine)
   24213 (Atp1a3)
  Exosomal proteins of colorectal cancer cells
   24213 (Atp1a3)
  Exosomal proteins of bladder cancer cells
   24213 (Atp1a3)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 24213
NCBI-ProteinID: NP_036638
RGD: 2169
Ensembl: ENSRNOG00000020263
UniProt: P06687
Structure
PDB: 
1BG5

Position
1
AA seq 1013 aa
MGDKKDDKSSPKKSKAKERRDLDDLKKEVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
ILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAGTEDDPSGDNL
YLGIVLAAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIREGEKMQVNAEEVVVGDL
VEIKGGDRVPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRNITFFSTNCV
EGTARGVVVATGDRTVMGRIATLASGLEVGKTPIAIEIEHFIQLITGVAVFLGVSFFILS
LILGYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGST
STICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKSSHTWVALSHIAGLCNR
AVFKGGQDNIPVLKRDVAGDASESALLKCIELSSGSVKLMRERNKKVAEIPFNSTNKYQL
SIHETEDPNDNRYLLVMKGAPERILDRCATILLQGKEQPLDEEMKEAFQNAYLELGGLGE
RVLGFCHYYLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRSAG
IKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVIHGTDL
KDFTSEQIDEILQNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADI
GVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPF
LLFIMANIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPRTDKLVNERLI
SMAYGQIGMIQALGGFFSYFVILAENGFLPGNLVGIRLNWDDRTVNDLEDSYGQQWTYEQ
RKVVEFTFHTAFFVSIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSY
CPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKETYY
NT seq 3042 nt   +upstreamnt  +downstreamnt
atgggggacaaaaaagatgacaagagctcgcccaagaagagcaaggccaaagagcgccgg
gacctggatgacctcaagaaggaagtggctatgacagagcacaagatgtcagtagaagag
gtctgccggaaatacaataccgactgcgtgcagggtctgacacacagtaaagcccaggag
atcctagcccgggatgggcctaacgccctcacaccaccgcccaccaccccagaatgggtc
aagttctgccgacagctatttggtggcttctccatcctgctgtggatcggggcgatcctt
tgcttcctggcctatggcatccaggcagggactgaggatgacccttccggtgacaatctg
tacctgggcatagtgctggccgctgtggtgatcatcaccggctgcttctcctactaccaa
gaagccaagagctctaagattatggagtccttcaagaacatggttccccagcaagccctt
gtgatccgggaaggtgaaaagatgcaggtgaatgcggaggaggtggtggtcggggacctg
gtggagatcaagggtggcgaccgggtgcccgctgacctgcgcatcatctcggcccatggc
tgcaaggtggacaactcttccctgactggcgaatctgagcctcagacccgctccccggac
tgcacacacgacaacccactggagacccggaacatcaccttcttttccaccaactgtgtg
gaaggcaccgctcgtggtgtggtggtagccacaggtgaccgcaccgtcatgggccgcatt
gccaccctggcctcaggcctggaggtgggcaagacgcccatcgccattgagatcgagcac
ttcatccagctcatcactggcgtggccgtgttcctgggcgtctccttcttcatcctctcc
ctcattctgggctacacctggctggaggctgtcatcttcctcatcggtatcattgtggcc
aatgtcccagaggggctgctggctactgtcacggtgtgtctgacgctgaccgccaagcgc
atggctcggaagaactgtctggtaaagaacctggaggcggtggagacgctaggctccaca
tccaccatctgctccgacaagaccggcaccctcacccagaaccgcatgaccgtcgcccac
atgtggtttgacaaccagatccacgaggccgacactactgaggatcagtcagggacctct
ttcgacaagagctcacacacctgggtggccctgtcccacatcgccggtctctgcaaccgg
gctgtcttcaagggcgggcaggataacatccctgtactcaagagggacgtggcgggtgat
gcctcagagtccgccctgcttaagtgcatcgagctgtcctcgggttccgtaaagctgatg
cgcgaacgaaacaagaaagtggccgagattcccttcaactccactaacaaataccagcta
tccatccatgagactgaggaccccaatgacaaccgatacctgttagtgatgaagggcgcc
cctgaacgcattctggaccgctgtgcgaccatcctcctgcagggcaaggagcagcctctg
gatgaggagatgaaggaggccttccagaacgcctacctggagcttggtggcctgggcgag
cgtgtgctgggtttctgccattactacctgccggaggaacagttccccaagggctttgcc
tttgactgtgatgacgtgaacttcaccacagacaacctttgcttcgtgggtctcatgtcc
atgatcgaccctccccgggcagctgtccctgatgctgtgggcaaatgccgcagtgcaggc
atcaaggtcatcatggtcaccggcgatcaccccatcactgcgaaggccatcgccaaaggt
gtaggcatcatctccgagggtaacgagactgtggaggacatcgctgcccggctcaacatc
cctgtcagccaggtcaaccccagggatgccaaagcctgtgtgattcatggcaccgacctc
aaggacttcacctctgagcagattgacgagatcctacagaaccacactgagatcgtcttt
gcccgaacctcccctcagcagaagctcatcatcgtggagggctgtcagagacagggagca
attgtggctgtgactggcgatggtgtgaatgactcccctgctctgaagaaggctgatatt
ggggtggccatgggcattgctggctctgatgtctctaagcaggctgccgacatgattctg
ctggatgacaattttgcttccattgtcactggtgtggaggaaggccgcctgatctttgac
aacctgaagaaatccatcgcctacactctgaccagcaacatccctgagatcacacccttc
cttctcttcatcatggccaacatcccactgccccttggcaccatcaccatcctctgcatt
gacctgggcaccgacatggtccctgcaatctccttggcctacgaggctgcagagagtgac
atcatgaagaggcagcccaggaacccacgcacagacaaactggtcaacgaaaggctcatc
agcatggcctatgggcagatcgggatgatccaggccctcggtggtttcttctcctacttt
gtcatcctggcagaaaatggtttcttgcccggtaacctggtgggcatccggctcaactgg
gatgaccgcactgtcaacgacctggaagacagctacgggcagcagtggacttatgagcag
aggaaggtggttgagttcacgttccacacagccttcttcgtgagcatagtggtggtccag
tgggctgacctgatcatttgcaagaccaggaggaattccgtcttccagcagggcatgaag
aataagatcttgatcttcggactgtttgaggaaacggccctcgctgccttcctgtcctac
tgcccaggcatggatgtggcccttcgcatgtacccgctcaagcccagctggtggttctgt
gccttcccctacagtttcctcatcttcgtctatgatgagattcgcaaactcatcctgcgc
aggaaccccgggggttgggtggagaaagagacctactattga

KEGG   Rattus norvegicus (rat): 24214
Entry
24214             CDS       T01003                                 

Gene name
Atp1b2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-2
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24214 (Atp1b2)
   04022 cGMP-PKG signaling pathway
    24214 (Atp1b2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24214 (Atp1b2)
   04918 Thyroid hormone synthesis
    24214 (Atp1b2)
   04919 Thyroid hormone signaling pathway
    24214 (Atp1b2)
   04925 Aldosterone synthesis and secretion
    24214 (Atp1b2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    24214 (Atp1b2)
   04261 Adrenergic signaling in cardiomyocytes
    24214 (Atp1b2)
  09154 Digestive system
   04970 Salivary secretion
    24214 (Atp1b2)
   04971 Gastric acid secretion
    24214 (Atp1b2)
   04972 Pancreatic secretion
    24214 (Atp1b2)
   04976 Bile secretion
    24214 (Atp1b2)
   04973 Carbohydrate digestion and absorption
    24214 (Atp1b2)
   04974 Protein digestion and absorption
    24214 (Atp1b2)
   04978 Mineral absorption
    24214 (Atp1b2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24214 (Atp1b2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24214 (Atp1b2)
   04964 Proximal tubule bicarbonate reclamation
    24214 (Atp1b2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    24214 (Atp1b2)
CD molecules [BR:rno04090]
 Proteins
  24214 (Atp1b2)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 24214
NCBI-ProteinID: NP_036639
RGD: 2171
Ensembl: ENSRNOG00000011227
UniProt: Q5M9H4
Position
10
AA seq 290 aa
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMW
VMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNISDTESWDQHVQKLNKFLEPYNDS
IQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDPTHYGYSTGQPCVFI
KMNRVINFYAGANQSMNVTCVGKKDEDAENLGHFIMFPANGNIDLMYFPYYGKKFHVNYT
QPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKA
NT seq 873 nt   +upstreamnt  +downstreamnt
atggtcatccaaaaagagaagaagagctgcgggcaggtggttgaggagtggaaggagttc
gtgtggaatcctcggacgcaccagttcatggggcgcaccgggaccagctgggccttcatc
ctcctcttctacctcgtcttctatggtttcctcacggccatgttcaccctcaccatgtgg
gtaatgctgcagaccgtctctgaccatacccccaagtaccaggatcgactggccacacca
ggcttgatgattcgacccaagactgagaaccttgatgtcattgtcaacattagcgacact
gaaagctgggatcagcatgttcagaagctcaacaagttcttggagccttacaacgactcc
atccaagctcaaaagaatgatgtctgccgtcctgggcgatattatgagcaacccgataat
ggggttctgaactatccaaaacgtgcctgccagttcaaccggacccagctgggcaattgc
tctggcattggggaccctactcactatggttacagcaccgggcagccctgtgtcttcatc
aaaatgaaccgggtcatcaacttctatgcaggggcaaaccagagcatgaacgttacctgt
gttgggaagaaagatgaagatgctgagaatcttggacacttcatcatgttccctgccaat
ggcaacatcgacctgatgtattttccctactatggcaaaaagttccatgtaaactataca
cagcccttggtggctgtgaagttcctgaatgtgacccccaatgtggaggtgaatgtagaa
tgccgaattaacgctgccaatattgccacggatgacgagcgggacaagtttgctggccgc
gtggccttcaagcttcgaatcaacaaagcctga

KEGG   Rattus norvegicus (rat): 25390
Entry
25390             CDS       T01003                                 

Gene name
Atp1b3
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-3
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25390 (Atp1b3)
   04022 cGMP-PKG signaling pathway
    25390 (Atp1b3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25390 (Atp1b3)
   04918 Thyroid hormone synthesis
    25390 (Atp1b3)
   04919 Thyroid hormone signaling pathway
    25390 (Atp1b3)
   04925 Aldosterone synthesis and secretion
    25390 (Atp1b3)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    25390 (Atp1b3)
   04261 Adrenergic signaling in cardiomyocytes
    25390 (Atp1b3)
  09154 Digestive system
   04970 Salivary secretion
    25390 (Atp1b3)
   04971 Gastric acid secretion
    25390 (Atp1b3)
   04972 Pancreatic secretion
    25390 (Atp1b3)
   04976 Bile secretion
    25390 (Atp1b3)
   04973 Carbohydrate digestion and absorption
    25390 (Atp1b3)
   04974 Protein digestion and absorption
    25390 (Atp1b3)
   04978 Mineral absorption
    25390 (Atp1b3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    25390 (Atp1b3)
   04961 Endocrine and other factor-regulated calcium reabsorption
    25390 (Atp1b3)
   04964 Proximal tubule bicarbonate reclamation
    25390 (Atp1b3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25390 (Atp1b3)
CD molecules [BR:rno04090]
 Proteins
  25390 (Atp1b3)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 25390
NCBI-ProteinID: NP_037045
RGD: 2172
Ensembl: ENSRNOG00000011501
UniProt: Q63377
Position
8
AA seq 279 aa
MTKTEKKSFHQSLAEWKLFIYNPTSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWV
MLQTLNDEVPKYRDQIPSPGLMVFPKPPTALDYTYSMSDPHTYKKFVEDLKNFLKPYSVE
EQKNLTDCPGGALFHQEGPDYSACQFPVSLLQECSGVNDSNFGYSKGQPCVLVKMNRIIE
LVPDGAPYITCITKEENIANIVTYPDDGLIDLKYFPYYGKKRHVGYRQPLVAVQVIFGAD
ATKKEVTIECQIDGTRNLKNKNERDKFLGRVSFKVIAHA
NT seq 840 nt   +upstreamnt  +downstreamnt
atgacgaagactgagaagaaatccttccaccagagcctggccgagtggaagctgttcatc
tacaacccgaccagcggagagtttctggggcgcacctccaagagctggggtctcatcttg
ctcttctacctagttttttatgggttcttggctgcactcttcacattcaccatgtgggtc
atgctccagactctgaatgacgaggttccgaagtaccgagaccagattcctagtccagga
cttatggttttccccaaaccaccgactgccttggattatacatacagcatgtctgaccca
catacttataaaaagtttgttgaagacctgaagaatttcctaaagccatattctgtggaa
gaacagaagaatctcacagattgccctggtggagcactttttcatcaggagggtccagac
tatagtgcgtgtcagttcccagtttccttgcttcaagaatgtagtggtgtgaatgattct
aattttggctactccaaaggacaaccttgtgttcttgtgaagatgaacagaataatcgag
ttagtcccagatggagctccatatattacatgtataacaaaggaagaaaacatagcaaat
atagtaacttatcctgatgatggacttatagacttaaagtattttccatattatgggaaa
aaacggcacgttggatatcgacagcccctagttgccgtccaggtcatatttggggccgat
gctaccaagaaagaagtaacaattgagtgccaaattgatggaaccaggaacctaaaaaac
aagaatgaacgtgacaagttcttgggacgagtttcatttaaagtcatagcacatgcctag

KEGG   Rattus norvegicus (rat): 25650
Entry
25650             CDS       T01003                                 

Gene name
Atp1b1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit beta-1
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    25650 (Atp1b1)
   04022 cGMP-PKG signaling pathway
    25650 (Atp1b1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    25650 (Atp1b1)
   04918 Thyroid hormone synthesis
    25650 (Atp1b1)
   04919 Thyroid hormone signaling pathway
    25650 (Atp1b1)
   04925 Aldosterone synthesis and secretion
    25650 (Atp1b1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    25650 (Atp1b1)
   04261 Adrenergic signaling in cardiomyocytes
    25650 (Atp1b1)
  09154 Digestive system
   04970 Salivary secretion
    25650 (Atp1b1)
   04971 Gastric acid secretion
    25650 (Atp1b1)
   04972 Pancreatic secretion
    25650 (Atp1b1)
   04976 Bile secretion
    25650 (Atp1b1)
   04973 Carbohydrate digestion and absorption
    25650 (Atp1b1)
   04974 Protein digestion and absorption
    25650 (Atp1b1)
   04978 Mineral absorption
    25650 (Atp1b1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    25650 (Atp1b1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    25650 (Atp1b1)
   04964 Proximal tubule bicarbonate reclamation
    25650 (Atp1b1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    25650 (Atp1b1)
CD molecules [BR:rno04090]
 Proteins
  25650 (Atp1b1)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 25650
NCBI-ProteinID: NP_037245
RGD: 2170
Ensembl: ENSRNOG00000002934
Vega: OTTRNOG00000001165
UniProt: P07340
Position
13
AA seq 304 aa
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLT
ISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDD
MIFEDCGSMPSEPKERGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCIIIKL
NRVLGFKPKPPKNESLETYPLTMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGFYGFP
LQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIECKAYGENIGYSEKDRFQGRFDVKI
EVKS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcccgcggaaaagccaaggaggaaggcagctggaagaaattcatctggaactcggag
aagaaggagtttttgggcaggaccggtggtagttggtttaagatccttctgttctacgtg
atattctatggctgcctggccggcatcttcatcgggaccatccaagtgatgctgcttacc
atcagtgagctgaaacccacgtaccaggaccgtgtggccccgccaggattgacacagatt
cctcagatccaaaagactgaaatttccttccgtcctaatgaccccaagagctacgaggcc
tatgtgctaaacatcatcaggttcctggaaaagtacaaagattcggcccagaaggacgac
atgattttcgaggattgtggcagtatgcccagtgaacccaaggagcggggagagttcaat
catgaacgaggagagcgcaaggtgtgcaggttcaagcttgactggctggggaactgctct
ggtctcaatgatgaatcctacggctacaaagaggggaagccctgtatcattatcaagctc
aaccgagtgctgggcttcaaacctaagcctcccaagaatgaatccttggagacttaccct
ctgacgatgaagtataatccaaacgtcctacctgtccagtgcactggcaagcgcgatgag
gataaggataaagttggaaacatagagtactttgggatgggcggattctatggctttcct
ctgcagtactatccctactacggcaaactcctgcagcccaagtacctgcagcccctgctg
gccgtgcagttcaccaacctcaccttggacactgaaatccgcattgagtgtaaggcgtat
ggtgagaacattgggtacagtgagaaagaccgttttcagggacgctttgatgtaaaaatt
gaagttaagagctga

KEGG   Rattus norvegicus (rat): 29132
Entry
29132             CDS       T01003                                 

Gene name
Atp1a4
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-4
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    29132 (Atp1a4)
   04022 cGMP-PKG signaling pathway
    29132 (Atp1a4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    29132 (Atp1a4)
   04918 Thyroid hormone synthesis
    29132 (Atp1a4)
   04919 Thyroid hormone signaling pathway
    29132 (Atp1a4)
   04925 Aldosterone synthesis and secretion
    29132 (Atp1a4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29132 (Atp1a4)
   04261 Adrenergic signaling in cardiomyocytes
    29132 (Atp1a4)
  09154 Digestive system
   04970 Salivary secretion
    29132 (Atp1a4)
   04971 Gastric acid secretion
    29132 (Atp1a4)
   04972 Pancreatic secretion
    29132 (Atp1a4)
   04976 Bile secretion
    29132 (Atp1a4)
   04973 Carbohydrate digestion and absorption
    29132 (Atp1a4)
   04974 Protein digestion and absorption
    29132 (Atp1a4)
   04978 Mineral absorption
    29132 (Atp1a4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    29132 (Atp1a4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    29132 (Atp1a4)
   04964 Proximal tubule bicarbonate reclamation
    29132 (Atp1a4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    29132 (Atp1a4)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     29132 (Atp1a4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29132 (Atp1a4)
  Exosomal proteins of other body fluids (saliva and urine)
   29132 (Atp1a4)
  Exosomal proteins of colorectal cancer cells
   29132 (Atp1a4)
  Exosomal proteins of bladder cancer cells
   29132 (Atp1a4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 HAD TAF
Other DBs
NCBI-GeneID: 29132
NCBI-ProteinID: NP_001257959
RGD: 61952
Ensembl: ENSRNOG00000032378
UniProt: Q64541 Q5PQV3
Position
13
AA seq 1028 aa
MEPGKETAATSEQKPRPTLRASNTNRQPKVKRRKKDLEELKKEVVMDDHKLTLDELSAKY
SVDLTKGLSVTDAQEILTLNGPNVLTPPPTTPEWIKFCKQLFGGFSLLLWTGSLLCFLAY
GIHVSYYQENANKDNLYLGIVLSAVVIITGCFSYYQEAKSSKIMESFKTMVPQQALVIRD
GEKMQINVRDVVLGDLVEVKGGDQVPADIRVIAAQGCKVDNSSLTGESEPQSRCPDCTHE
NPLETRNIIFFSTNCVEGTARGVVIATGDHTVMGRIASLTSGLTMGKTPIATEIEHFIHI
ITAVAVFLGVTFFFLSLILGYTWLDAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARK
NCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHLWFDKTVYEADTSEEQTTGKTFPK
SSDTWFYLARIAGLCNRADFKPHQESLPITKRTTTGDASESALLKFIEQSYSPVSEMRQK
NPKVAEIPFNSTNKYQMSIHLLEDNSEAHVLLMKGAPERILDFCSSFLLNGQEYPMDEEM
KTDFQNAYIELGGLGERVLGFCFLNLPSNFSKGFQFNTEELNFPMENLCFAGLISMIDPP
RTAVPDAVSKCRSAGIKVIMVTGDHPITAKAIAKSVGIISEANETAEDIAARLNISISQV
SNKSIKAIVVHGSELKDMDSGQLDNILKSYKEIVFARTSPQQKLIIVEGCQRLGAIVAVT
GDGVNDSPALKKADIGIAMGITGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKS
IAYTLTSNIPEITPFLLFIVLSIPLPLGTITILCIDLGTDMVPAISLAYETPESDIMKRL
PRNPKTDNLVNDRLIGMAYGQIGMIQALAGFFTYFVILAENGFKPLDLLGIRLYWDDTNL
NDLEDTYGQQWTYEQRKVVEFTCQTAFFISIVIVQWADLIICKTRRNSLFKQGMKNKVLI
FGLLEETILAACLSYIPGMDVALRMYPLKINWWFCALPYSVLIFIYDEVRKLIIRRRPGG
WLEKETYY
NT seq 3087 nt   +upstreamnt  +downstreamnt
atggagcctggaaaagagacagcggccactagtgagcagaagccaagacccacccttagg
gcttcaaatacgaatagacagccgaaagtgaaaagaaggaagaaagatttagaggagttg
aagaaggaagtggttatggacgatcacaagctaacgttggatgagctgagtgccaagtac
tctgtggacttgaccaagggtcttagcgtcacagatgcccaggaaattctgactctaaat
ggaccgaatgtactaacccctcctccaaccactccagaatggatcaaattctgtaaacaa
ttatttggtggcttctccctcctgctgtggactggttccttgctctgcttcctggcctat
ggcatacatgtatcttattaccaagaaaacgccaacaaagataatctgtacctgggtatt
gtactatctgccgtggtcatcatcactggctgcttctcatattaccaggaggcgaagagc
tcaaagatcatggagtcttttaagaccatggtgcctcagcaagctctggtaattcgagat
ggagagaaaatgcagatcaatgtaagagatgtggttttgggagacctagtagaagtgaag
ggtggagaccaagtccctgctgatatcagggttatcgctgcgcaaggatgtaaggtagac
aattcctccttgactggggagtcagaaccacagtctcgttgccctgattgcacccatgag
aaccctctggagacacggaatatcatcttcttctccaccaactgcgtagaaggaacagcc
cggggtgttgtgattgctacaggagaccacacagtaatgggccggattgcttccctgaca
tcaggattgacaatgggcaagaccccgattgccactgaaatcgaacacttcatccatata
atcacagctgtcgcagtcttcctcggtgtcacgttttttttcctctcacttatcttgggc
tatacctggctggatgctgtcattttccttattggcatcattgtggccaatgtgccagaa
gggctgctggccactgtcactgtgtgcctgacgctgacagccaagcgcatggctcgcaag
aactgcctggtgaagaacctggaggcggtggagacgctgggctccacgtccaccatctgc
tcggacaagactggcaccctcacccagaaccgcatgacggtggctcatctgtggtttgat
aagactgtgtatgaggctgacaccagcgaggagcaaaccacggggaaaacatttcccaag
tcctctgacacctggttttacctggctcgaattgctggcctctgcaaccgggccgacttt
aagcctcatcaggagtctcttcccataactaagcggacaacaacaggggatgcttctgag
tcagccctcctcaaattcattgagcagtcttacagccctgtgagtgaaatgagacagaaa
aaccccaaggtggcagagattccttttaattctaccaacaagtaccagatgtctattcac
cttctggaagataactcagaagcccacgtgctgctgatgaaaggtgctccagaaaggatc
ttggatttttgctccagtttcctgctcaatgggcaggagtaccctatggacgaagaaatg
aagacagacttccagaatgcctacatagaactgggaggtctgggcgagcgtgtgctgggg
ttctgcttcttgaatttgcctagcaatttctctaagggattccaatttaataccgaagaa
ttaaattttcccatggagaatctgtgtttcgccggcctcatatctatgatcgaccctcct
cgaacggctgtgcctgatgctgttagcaagtgccgaagtgcagggattaaggtaatcatg
gtaacaggggatcatcccatcacagccaaagctattgccaaaagtgtgggcatcatttca
gaagctaatgaaacggcggaggacatcgctgctcggcttaatatctccatcagtcaagtc
agtaacaagtctattaaagccattgtagtgcacggctcagagctgaaggacatggactca
ggtcagctggacaatatcctcaagtcctacaaggagatcgtgtttgcgcggacctctcct
cagcagaagctcatcatcgtggagggctgtcagagactgggagccattgtggcagtgact
ggtgacggggtgaacgactcccccgcgctgaagaaggctgacatcggcattgccatgggc
atcactggctctgatgtctctaagcaggcggctgacatgatccttctcgacgacaacttt
gcctccattgtgacgggcgtggaggagggtcgcctcatctttgacaacctgaagaagtcc
atcgcctataccctgaccagcaacatccctgagatcacccccttcctgctgttcatcgtc
ttaagtatacccttgcctctgggtaccattaccattctctgcattgacctgggtactgac
atggtccctgctatctccttggcttatgagacacctgaaagtgacatcatgaaaaggctt
ccacggaaccccaaaactgacaatctcgtgaacgaccgtcttatcggcatggcctatggg
cagatcgggatgatacaggcgctggctggatttttcacctatttcgtgatcctggcggag
aatggttttaagcctcttgatcttctgggtatccgtctatactgggatgatacaaaccta
aatgacctagaggacacctatgggcagcagtggacctatgagcagcggaaggtggtggag
ttcacatgccaaacagccttcttcatcagcatcgtgatcgtgcagtgggctgacctcatc
atctgcaagacgcgcagaaattcactcttcaagcagggcatgaaaaacaaagtcctaata
tttggactccttgaggagacgatcctggcagcttgcctgtcctacattccaggcatggat
gtagccctgagaatgtacccactcaagataaactggtggttctgcgcacttccctacagt
gttctcatcttcatctatgatgaagttcgaaaactcatcatccgcagacggcccggtgga
tggctggagaaggagacgtactactaa

KEGG   Rattus norvegicus (rat): 29639
Entry
29639             CDS       T01003                                 

Gene name
Fxyd2
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit gamma isoform a
  KO
K01538  sodium/potassium-transporting ATPase subunit gamma (FXYD domain-containing ion transport regulator 2)
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    29639 (Fxyd2)
   04022 cGMP-PKG signaling pathway
    29639 (Fxyd2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    29639 (Fxyd2)
   04918 Thyroid hormone synthesis
    29639 (Fxyd2)
   04919 Thyroid hormone signaling pathway
    29639 (Fxyd2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29639 (Fxyd2)
   04261 Adrenergic signaling in cardiomyocytes
    29639 (Fxyd2)
  09154 Digestive system
   04970 Salivary secretion
    29639 (Fxyd2)
   04972 Pancreatic secretion
    29639 (Fxyd2)
   04976 Bile secretion
    29639 (Fxyd2)
   04973 Carbohydrate digestion and absorption
    29639 (Fxyd2)
   04974 Protein digestion and absorption
    29639 (Fxyd2)
   04978 Mineral absorption
    29639 (Fxyd2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    29639 (Fxyd2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    29639 (Fxyd2)
   04964 Proximal tubule bicarbonate reclamation
    29639 (Fxyd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    29639 (Fxyd2)
   04147 Exosome [BR:rno04147]
    29639 (Fxyd2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   29639 (Fxyd2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29639 (Fxyd2)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 Gram_pos_anchor
Other DBs
NCBI-GeneID: 29639
NCBI-ProteinID: NP_663769
RGD: 2173
Ensembl: ENSRNOG00000016469
UniProt: Q04679
Position
8
AA seq 66 aa
MTELSANHGGSAKGTENPFEYDYETVRKGGLIFAGLAFVVGLLILLSKRFRCGGSKKHRQ
VNEDEL
NT seq 201 nt   +upstreamnt  +downstreamnt
atgacagagctgtcagctaaccatggtggcagtgccaaggggacggagaatcccttcgag
tatgactatgaaaccgtccgcaaaggaggcctgatcttcgcgggccttgccttcgtcgtg
ggactcctcattctcctcagcaaaagattccgctgtgggggcagtaagaagcataggcag
gtcaatgaagatgagctgtga

KEGG   Rattus norvegicus (rat): 84396
Entry
84396             CDS       T01003                                 

Gene name
Atp1b4
Definition
(RefSeq) protein ATP1B4
  KO
K01540  sodium/potassium-transporting ATPase subunit beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    84396 (Atp1b4)
   04022 cGMP-PKG signaling pathway
    84396 (Atp1b4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    84396 (Atp1b4)
   04918 Thyroid hormone synthesis
    84396 (Atp1b4)
   04919 Thyroid hormone signaling pathway
    84396 (Atp1b4)
   04925 Aldosterone synthesis and secretion
    84396 (Atp1b4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    84396 (Atp1b4)
   04261 Adrenergic signaling in cardiomyocytes
    84396 (Atp1b4)
  09154 Digestive system
   04970 Salivary secretion
    84396 (Atp1b4)
   04971 Gastric acid secretion
    84396 (Atp1b4)
   04972 Pancreatic secretion
    84396 (Atp1b4)
   04976 Bile secretion
    84396 (Atp1b4)
   04973 Carbohydrate digestion and absorption
    84396 (Atp1b4)
   04974 Protein digestion and absorption
    84396 (Atp1b4)
   04978 Mineral absorption
    84396 (Atp1b4)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    84396 (Atp1b4)
   04961 Endocrine and other factor-regulated calcium reabsorption
    84396 (Atp1b4)
   04964 Proximal tubule bicarbonate reclamation
    84396 (Atp1b4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    84396 (Atp1b4)
CD molecules [BR:rno04090]
 Proteins
  84396 (Atp1b4)
SSDB
Motif
Pfam: Na_K-ATPase MTABC_N Paf1
Other DBs
NCBI-GeneID: 84396
NCBI-ProteinID: NP_445833
RGD: 620994
Ensembl: ENSRNOG00000007059
UniProt: Q9R193
Position
X
AA seq 356 aa
MRRQLRSRRAPAFPYGYRYRLDDQDEVNHNYLADEEEEAEEEAQVMMVPGLEEEEEEEEG
KEEEEEREEEEGQGQSTGNAWWRKLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYA
SLAAVITLFIYMLFLAISPYMPTFTEQVKPPGVMIRPFAHSLNFNFNVSEPETWQRYVIS
LNGFLQGYNDSLQEEMNIDCPPGQYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYS
TGQPCILLKMNRIVGFRPEFGDPVKVSCKVQKGDENNIRSINYYPESASFDLRYYPYYGK
LTHVNYTSPLVAMHFTDVVKNQEVPVQCQLKGKGIVNDVINDRFVGRIIFTLNIET
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagacggcaactccgctccagaagggcgccggcctttccttatggttaccgctacaga
cttgatgatcaggatgaagtgaatcacaactacttagcggacgaagaggaggaagcagaa
gaagaggctcaggtgatgatggtgcctggtctggaggaagaggaagaagaggaggaagga
aaagaggaggaggaagaaagggaggaagaagaaggtcagggtcagtcaacaggcaatgcc
tggtggcggaaattgcagatcgtgaatgaatacctgtgggacccggagaaaaggatgtct
ctggcccgaacaggtcagagtcggagtcttattttagtcatttacttcttcttctatgcc
tccctggctgccgtgatcaccctattcatatatatgctgttcctagccatcagtccttac
atgccgaccttcacggagcaggtgaaacctcctggagttatgatcagacccttcgctcat
agccttaacttcaacttcaacgtttctgaacctgaaacttggcagcgttatgtcattagc
ctaaatggctttctccagggctataatgacagtcttcaagaggaaatgaatatagattgt
cctcccggtcagtacttcatccaagatggagatgaagatgaggacaagaaggcctgccaa
tttaaacgctccttcctgaagaattgctctgggctggaggaccccacttttggatattct
actggacagccttgcatccttctcaagatgaaccggattgtaggctttcgtcctgaattt
ggagatcctgtgaaggtgtcctgcaaagttcagaaaggtgatgaaaacaacattcgatcc
atcaattactacccggagtcagcttcttttgacctccgctactacccttactatggcaaa
ctgactcacgttaactacacctccccgctggtggcaatgcattttacagacgtggtgaag
aaccaagaagtgcctgtacagtgccagctgaagggcaaaggcatcgtaaatgacgtcatc
aatgatcgtttcgtcgggaggataatctttaccctgaacatagaaacctag

DBGET integrated database retrieval system