KEGG   Rattus norvegicus (rat): 24212
Entry
24212             CDS       T01003                                 

Gene name
Atp1a2, RATATPA2
Definition
(RefSeq) ATPase Na+/K+ transporting subunit alpha 2
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04260  Cardiac muscle contraction
rno04261  Adrenergic signaling in cardiomyocytes
rno04911  Insulin secretion
rno04918  Thyroid hormone synthesis
rno04919  Thyroid hormone signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04960  Aldosterone-regulated sodium reabsorption
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04964  Proximal tubule bicarbonate reclamation
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
rno04973  Carbohydrate digestion and absorption
rno04974  Protein digestion and absorption
rno04976  Bile secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24212 (Atp1a2)
   04022 cGMP-PKG signaling pathway
    24212 (Atp1a2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24212 (Atp1a2)
   04918 Thyroid hormone synthesis
    24212 (Atp1a2)
   04919 Thyroid hormone signaling pathway
    24212 (Atp1a2)
   04925 Aldosterone synthesis and secretion
    24212 (Atp1a2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    24212 (Atp1a2)
   04261 Adrenergic signaling in cardiomyocytes
    24212 (Atp1a2)
  09154 Digestive system
   04970 Salivary secretion
    24212 (Atp1a2)
   04971 Gastric acid secretion
    24212 (Atp1a2)
   04972 Pancreatic secretion
    24212 (Atp1a2)
   04976 Bile secretion
    24212 (Atp1a2)
   04973 Carbohydrate digestion and absorption
    24212 (Atp1a2)
   04974 Protein digestion and absorption
    24212 (Atp1a2)
   04978 Mineral absorption
    24212 (Atp1a2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    24212 (Atp1a2)
   04961 Endocrine and other factor-regulated calcium reabsorption
    24212 (Atp1a2)
   04964 Proximal tubule bicarbonate reclamation
    24212 (Atp1a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24212 (Atp1a2)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     24212 (Atp1a2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   24212 (Atp1a2)
  Exosomal proteins of other body fluids (saliva and urine)
   24212 (Atp1a2)
  Exosomal proteins of colorectal cancer cells
   24212 (Atp1a2)
  Exosomal proteins of bladder cancer cells
   24212 (Atp1a2)
SSDB
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 Sigma70_r4
Other DBs
NCBI-GeneID: 24212
NCBI-ProteinID: NP_036637
RGD: 2168
Ensembl: ENSRNOG00000007290
UniProt: P06686
Position
13q24
AA seq 1020 aa
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDILARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGALLCFLAYGILAAME
DEPSNDNLYLGIVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGQTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPREAKAC
VVHGSDLKDMTSEQLDEILRDHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTTNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgggtcgtggggcagggcgtgagtactcgcctgccgccaccactgcggagaatgggggt
ggcaagaagaaacagaaagagaaggagctcgatgagctgaagaaggaggttgccatggat
gaccacaagctgtccttggatgagctgggccgaaaataccaagtggatctgtccaagggc
ctcaccaaccagcgagctcaggatattctggctagagacggacccaacgccctcactcca
ccccctacaactcctgagtgggtcaagttctgccgtcagctttttgggggcttctctatc
ctgctgtggattggggcgcttctctgcttcttagcctatggtatcctggccgccatggag
gacgaaccatccaatgacaatttatatctaggtatcgtgctagcagctgtagttatcgtc
actggctgcttctcctactaccaggaagccaaaagctccaagattatggactccttcaag
aacatggtgcctcagcaagctctggtcatccgagagggagagaagatgcagatcaatgca
gaggaggtggtcgtgggagacctggtggaagtgaagggtggagaccgtgtccccgctgac
ctccggatcatctcctcccacggttgcaaggtggataactcatccctgacaggggagtcg
gagccccagacccggtcccctgagttcacccatgagaatcccttggagacccgcaatatc
tgtttcttctctaccaactgtgtggaaggcactgccaggggcattgtgatcgccacaggt
gaccggacggtgatgggccgcatagccactcttgcctctggcctagaggtgggacagacg
ccgatagccatggagatcgagcatttcatccagctgatcacgggggtggccgtgttcctg
ggggtctccttctttgttctgtcgctcatcctgggctacagctggctggaggctgtcatc
ttcctcatcggcatcatcgtagccaacgtccccgaagggctcttggccactgttactgtg
tgcctgacgctgacagccaagcgcatggctcgcaagaactgcctggtgaagaacctggag
gcggtggagacgctgggctccacgtccaccatctgctcggacaagacaggcaccctcacc
cagaaccgcatgacggtggctcacatgtggtttgacaaccagatccatgaggctgacacc
actgaagatcagtctggggccacttttgacaagcggtccccgacgtggacagccctgtct
cggatcgctggtctctgcaatcgtgccgtcttcaaggctgggcaggagaacatctccgtg
tctaagcgggacacagctggtgacgcctctgagtcagctctgctcaagtgcatcgagttg
tcctgtggctcagtgaggaagatgagggacaggaatcccaaggtggcagaaattcccttc
aactctaccaacaaatatcagctttccatccatgagagggaagacagcccccagagccat
gtgctggtgatgaaaggtgccccggagcgcatcctggaccgatgctctaccatcctggta
cagggcaaggagatccctcttgacaaggagatgcaagatgcctttcaaaacgcctacatg
gagctgggaggactcggggagcgagtgctgggcttctgtcagctgaacctgccttctgga
aagtttcctcggggcttcaaatttgacacggatgagctgaactttcccacagagaagctc
tgctttgtggggctcatgtctatgattgatccccccagagcagctgtgccagatgctgtg
ggcaagtgcagaagtgcaggcatcaaggtgatcatggtgactggggatcaccctatcaca
gccaaggccattgccaaaggtgtgggcatcatatcagagggtaacgagactgtggaagac
attgcagccaggctcaacattcctgtgagtcaagtcaatcccagagaagccaaggcatgt
gtagtgcacggctcagacctgaaggacatgacttcagagcagctggatgagatcctcagg
gaccacacggagatcgtgtttgcccggacctcccctcagcagaagctcatcattgtggag
ggctgtcagaggcagggagccatcgtggcagtgactggtgacggggtgaacgactccccc
gcgctgaagaaggctgacattggcattgccatgggcatctctggctctgatgtctctaag
caggcagctgacatgatccttctcgacgacaactttgcctccattgtgacgggcgtggag
gaggggcgcctgatctttgacaacctgaagaagtccatcgcgtacaccctgaccagcaac
atccctgagatcacccccttcctgctgttcatcattgccaacatcccccttcccctgggc
accgtgaccatcctgtgcatcgacctgggcacagacatggttcctgccatctcattagca
tacgaagcggctgagagcgacatcatgaagaggcagccacggaactcccagacggacaag
ctggtgaacgagaggcttatcagcatggcttacggacagatcggcatgatccaggctctg
ggcggcttcttcacctactttgtaatactggcagagaacggcttcctgccatcgaggctg
cttgggatccgccttgactgggatgatcggactaccaacgacctggaggacagctatgga
caagagtggacctatgagcagcggaaggtggtggagttcacatgccacacggccttcttt
gccagcatcgtggttgtgcagtgggctgacctcatcatttgcaagacccggcgcaactcg
gtgttccagcagggcatgaagaacaagatcctgatttttgggctgctagaagagacggct
ctggctgccttcctgtcttactgcccgggtatgggggtggccctccgaatgtacccactc
aaggtcacgtggtggttctgtgcctttccctacagtctcctcatcttcatctatgatgaa
gtccgaaagctcatcctgcggcggtaccctgggggctgggtggagaaggagacgtactac
tga

DBGET integrated database retrieval system