KEGG   Rattus norvegicus (rat): 24215
Entry
24215             CDS       T01003                                 

Gene name
Atp2b2
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 2
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04925  Aldosterone synthesis and secretion
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24215 (Atp2b2)
   04024 cAMP signaling pathway
    24215 (Atp2b2)
   04022 cGMP-PKG signaling pathway
    24215 (Atp2b2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    24215 (Atp2b2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24215 (Atp2b2)
  09154 Digestive system
   04970 Salivary secretion
    24215 (Atp2b2)
   04972 Pancreatic secretion
    24215 (Atp2b2)
   04978 Mineral absorption
    24215 (Atp2b2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    24215 (Atp2b2)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     24215 (Atp2b2)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase ATP_Ca_trans_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3
Other DBs
NCBI-GeneID: 24215
NCBI-ProteinID: NP_036640
RGD: 2176
Ensembl: ENSRNOG00000030269
UniProt: P11506
Position
4
AA seq 1198 aa
MGDMTNSDFYSKNQRNESSHGGEFGCSMEELRSLMELRGTEAVVKIKETYGDTESICRRL
KTSPVEGLPGTAPDLEKRKQIFGQNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIISLG
LSFYHPPGESNEGCATAQGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEKQFR
GLQSRIEQEQKFTVVRAGQVVQIPVAEIVVGDIAQIKYGDLLPADGLFIQGNDLKIDESS
LTGESDQVRKSVDKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEKKD
KKAKQQDGAAAMEMQPLKSAEGGDADDKKKANMHKKEKSVLQGKLTKLAVQIGKAGLVMS
AITVIILVLYFTVDTFVVNKKPWLTECTPVYVQYFVKFFIIGVTVLVVAVPEGLPLAVTI
SLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQAYVGDVHYKEIP
DPSSINAKTLELLVNAIAINSAYTTKILPPEKEGALPRQVGNKTECGLLGFVLDLRQDYE
PVRSQMPEEKLYKVYTFNSVRKSMSTVIKMPDESFRMYSKGASEIVLKKCCKILSGAGEP
RVFRPRDRDEMVKKVIEPMACDGLRTICVAYRDFPSSPEPDWDNENDILNELTCICVVGI
EDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAIKCGIIHPGEDFLCLEGKEFNRR
IRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGIIDSTHTEQRQVVAVTGDGTNDG
PALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSISKFLQFQLTV
NVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTETLLLRKPYGRNKP
LISRTMMKNILGHAVYQLTLIFTLLFVGEKMFQIDSGRNAPLHSPPSEHYTIIFNTFVMM
QLFNEINARKIHGERNVFDGIFRNPIFCTIVLGTFAIQIVIVQFGGKPFSCSPLQLDQWM
WCIFIGLGELVWGQVIATIPTSRLKFLKEAGRLTQKEEIPEEELNEDVEEIDHAERELRR
GQILWFRGLNRIQTQIRVVKAFRSSLYEGLEKPESRTSIHNFMAHPEFRIEDSQPHIPLI
DDTDLEEDAALKQNSSPPSSLNKNNSAIDSGINLTTDTSKSATSSSPGSPIHSLETSL
NT seq 3597 nt   +upstreamnt  +downstreamnt
atgggtgatatgaccaacagcgacttttactccaaaaaccaaagaaatgagtcgagccat
gggggcgagttcgggtgcagcatggaggagctgcgctccctcatggagctgcggggcact
gaggctgtggtcaagatcaaggagacatatggggacactgaatccatctgccggcgcctc
aaaacctctcctgttgaaggtttgccaggcaccgctccagacctggaaaagaggaaacag
attttcgggcaaaacttcatacctccaaagaaaccaaaaaccttcctgcagctggtgtgg
gaagcactacaggacgtgacgctcatcatcctggagatcgcggccatcatctccctggga
ctgtccttctaccacccacccggagagagcaatgaaggatgtgccacggcccaaggtggg
gcagaagatgaaggtgaagcagaagcaggctggatcgagggggctgccatcctgctgtca
gtcatctgtgtggtcctcgtcacagccttcaatgattggagtaaagagaaacagttccgg
ggcctgcagagccgaattgagcaggaacagaagttcaccgtagtccgggctggccaggtg
gtccagatccctgtggccgagattgtggttggggacattgcccagatcaaatacggtgac
ctccttcctgctgatggcctcttcatccagggcaatgacctcaagatcgatgaaagctcg
ctcacaggggagtctgaccaggtgcgcaagtctgtggataaggaccctatgttgctgtca
ggaactcatgtgatggaaggctcaggacggatggtggtgactgctgtgggtgtcaactct
caaactggcatcatatttaccctgcttggggctggtggtgaagaggaagagaagaaagac
aaaaaagccaagcagcaggatggggcagctgctatggaaatgcagcctctgaagagtgcg
gagggcggtgatgcagatgacaagaagaaagccaacatgcacaagaaagagaagtcggtg
cttcagggcaagctcaccaagctggctgtgcagataggcaaggcgggcctggtgatgtcg
gccatcacggtgatcatcctggtgctctacttcaccgtggacaccttcgtggtcaacaag
aagccgtggctgacggagtgcacaccggtctacgtgcagtacttcgtcaagttcttcatc
attggtgtgacggtgctggtggtcgctgtgcccgagggcctccctctggctgtcaccatc
tcactggcctattccgtgaagaaaatgatgaaggacaacaacctggtccgtcacctggac
gcctgtgagaccatgggtaacgccacagccatctgctcagacaagacaggcacgctgacc
accaaccgcatgaccgtggtgcaggcctatgtcggtgatgtccactacaaggagatccct
gatcccagctccatcaatgccaagacattggagctgctggtcaacgccattgccatcaac
agcgcctacaccaccaagatcctccccccagaaaaagagggcgccctgccccggcaggtg
ggcaacaagacagagtgtggcctgctgggcttcgtgctggacctgaggcaggattacgag
ccggtacgcagccagatgccagaggaaaagctgtataaggtgtacaccttcaactctgtg
cgcaagtccatgagcaccgtcatcaagatgcctgacgagagcttccgcatgtacagcaaa
ggtgcttcggagattgtgctcaaaaagtgctgcaagattctcagtggggcaggggagccc
cgtgtcttccggccccgtgacagggatgagatggttaagaaggtgatcgagcccatggcc
tgtgacgggctccgtaccatctgtgtggcctatcgtgacttccccagcagccctgagcct
gactgggacaatgagaatgacattctcaatgaactcacctgcatctgcgtggtgggcatc
gaagacccagtgcgacctgaggtcccagaagccatccgcaagtgccagcgggccggtatc
acagtccgcatggtcaccggtgacaacatcaacacagcccgggccatcgccatcaagtgt
ggcattatccaccctggagaggacttcctgtgcctggaaggcaaagaattcaatcggagg
atccgcaacgagaagggggagattgagcaggagcggattgacaagatctggccaaagctg
agggtgctggctcgatcctcgcccacggataagcacaccctggtcaaaggcatcatcgac
agcacacacactgagcagcggcaggtggtggctgtgacaggggatgggaccaacgatggg
cctgctctcaagaaggcagatgtgggcttcgcgatgggcatcgcaggcacggatgtggcc
aaggaggcctcagacatcatcctgacagacgacaacttcagcagcatcgttaaggcagtg
atgtggggccgtaatgtctatgacagcatatccaaattcctgcagtttcagctgactgtc
aatgtggtggctgtgatcgtggccttcacgggtgcctgcattacacaggactcccctctc
aaggcggtgcagatgctctgggtgaacctcatcatggacacatttgcttccctggccctg
gcaacagagccacccaccgagactctgctcctgaggaaaccttacggccgcaacaagccg
ctcatctcgagaaccatgatgaagaacatcctgggccacgccgtctaccagctaaccctc
atcttcaccctgctcttcgtgggtgagaagatgttccagattgacagcggaaggaacgcc
ccgctgcactcgccaccctcggagcactacaccatcatcttcaacaccttcgtcatgatg
cagcttttcaacgagatcaacgcccgtaagatccacggcgagcgtaacgtcttcgacgga
atcttccggaaccccatcttctgcaccatcgttctcggcacttttgccatccagatagtg
attgtgcagttcggcggcaaacccttcagctgctccccactccagctggaccagtggatg
tggtgcatcttcataggcctgggagagctcgtctggggccaggtcattgccaccatccct
accagcaggctcaagtttctgaaagaggcagggcggctaacacagaaggaggagatcccc
gaggaagagttaaatgaggatgtggaagagatagaccacgcagagcgggagcttcgccga
ggccagatcctatggttccggggcctgaatcggatccagacacagatccgcgtcgtgaag
gcgttccgtagctctctctatgaagggttagaaaaacccgagtctcgaacctccatccat
aacttcatggctcatcctgaattccggatcgaagattcccagccccacatccccctcatc
gatgacaccgacctggaagaagatgccgcgctcaagcagaactcgagcccgccgtcctcg
ctcaacaagaacaatagcgccatcgacagcgggatcaacctgacgaccgacacgagcaaa
tcagctacctcttcaagtccagggagccccatccacagcctggagacgtcgctttag

KEGG   Rattus norvegicus (rat): 29598
Entry
29598             CDS       T01003                                 

Gene name
Atp2b1
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 1
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04925  Aldosterone synthesis and secretion
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29598 (Atp2b1)
   04024 cAMP signaling pathway
    29598 (Atp2b1)
   04022 cGMP-PKG signaling pathway
    29598 (Atp2b1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    29598 (Atp2b1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29598 (Atp2b1)
  09154 Digestive system
   04970 Salivary secretion
    29598 (Atp2b1)
   04972 Pancreatic secretion
    29598 (Atp2b1)
   04978 Mineral absorption
    29598 (Atp2b1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29598 (Atp2b1)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     29598 (Atp2b1)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Cation_ATPase_N ATP_Ca_trans_C Hydrolase Hydrolase_3 DUF2201_N
Other DBs
NCBI-GeneID: 29598
NCBI-ProteinID: NP_445763
RGD: 621303
Ensembl: ENSRNOG00000004026
UniProt: P11505
Position
7
AA seq 1176 aa
MGDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGIC
TKLKTSPNEGLSGNPADLERREAVFGKNFIPPKKPKTFLQLVWEALQDVTLIILEIAAIV
SLGLSFYQPPEGDNALCGEVSVGEEEGEGETGWIEGAAILLSVVCVVLVTAFNDWSKEKQ
FRGLQSRIEQEQKFTVIRGGQVIQIPVADITVGDIAQVKYGDLLPADGILIQGNDLKIDE
SSLTGESDHVKKSLDKDPLLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEEK
KDEKKKEKKNKKQDGAIENRNKAKAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKS
VLQGKLTKLAVQIGKAGLLMSAITVIILVLYFVIDTFWVQKRPWLAECTPIYIQYFVKFF
IIGVTVLVVAVPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTL
TMNRMTVVQAYINEKHYKKVPEPEAIPPNILSYLVTGISVNCAYTSKILPPEKEGGLPRH
VGNKTECALLGFLLDLKRDYQDVRNEIPEEALYKVYTFNSVRKSMSTVLKNSDGSFRIFS
KGASEIILKKCFKILSANGEAKVFRPRDRDDIVKTVIEPMASEGLRTICLAFRDFPAGEP
EPEWDNENDVVTGLTCIAVVGIEDPVRPEVPEAIKKCQRAGITVRMVTGDNINTARAIAT
KCGILHPGEDFLCLEGKDFNRRIRNEKGEIEQERIDKIWPKLRVLARSSPTDKHTLVKGI
IDSTVSEQRQVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVK
AVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTLASL
ALATEPPTESLLLRKPYGRNKPLISRTMMKNILGHAFYQLVVVFTLLFAGEKFFDIDSGR
NAPLHAPPSEHYTIVFNTFVLMQLFNEINARKIHGERNVFEGIFNNAIFCTIVLGTFVVQ
IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQLISTIPTSRLKFLKEAGHGTQKEE
IPEEELAEDVEEIDHAERELRRGQILWFRGLNRIQTQMDVVNAFQSGGSIQGALRRQPSI
ASQHHDVTNVSTPTHVVFSSSTASTPVGYPSGECIS
NT seq 3531 nt   +upstreamnt  +downstreamnt
atgggcgacatggcaaacaactcagttgcatatagtggtgtgaaaaactctttgaaagaa
gctaatcatgatggcgactttggcatcacacttgccgagctgcgggccctcatggagctc
aggtccacagatgcattacgaaaaatacaggaaagctatggggatgtctatggaatttgc
accaagttgaaaacatctcccaatgaaggtttaagtggaaatcctgcagatttagaaaga
agagaagcagtgtttggaaagaactttatacctcctaagaagccaaaaacctttcttcag
ttagtatgggaagcattacaagatgtcactttaattatactagaaatcgcagccatagta
tcattgggcctttctttttatcaacctccggaaggggataatgcactttgtggagaagtt
tctgttggggaagaagaaggtgaaggagaaacggggtggattgaaggagctgccatcctc
ttgtcggtggtgtgtgtggtgttagtgacggctttcaatgactggagtaaggagaaacag
ttccgaggcttgcagagtcgaattgaacaggaacagaagttcaccgtcatcaggggtggg
caggtcatccagatacctgtagctgacattactgttggagacattgcccaagtgaagtac
ggtgatcttcttccagctgatggtatattgattcaaggcaatgaccttaaaattgacgag
agttcgttgactggcgagtctgaccatgttaagaagtctctagataaagaccccttgctt
ctttcaggtactcatgtaatggaaggttctggaaggatggtcgttactgctgtaggtgtg
aactctcaaactgggatcatctttaccttacttggagctggaggcgaagaggaggaaaag
aaagatgagaagaagaaagaaaagaaaaataagaaacaagatggagcaattgaaaatcgc
aacaaagcaaaagcccaagacggcgcggccatggagatgcagcctctgaagagtgaagaa
gggggagatggtgatgagaaagacaagaagaaagcaaatctgccaaagaaggaaaagtct
gtgttacaagggaaacttacgaagctggctgttcagattggcaaagcaggtctgctgatg
tctgccatcacggttatcatcctagtgctatattttgtgatcgataccttctgggttcag
aagaggccgtggcttgctgagtgcacgccaatctacatccagtactttgtgaagttcttc
attatcggggtcaccgttctagtggtcgcggtgccggaaggcctcccgctggccgtcacg
atctcactggcttactccgtcaagaaaatgatgaaggataacaacttggtgaggcacctg
gatgcttgtgagaccatggggaacgctacagctatctgttccgataagacggggaccctg
acgatgaacaggatgacggtcgttcaggcctacatcaacgaaaagcattataaaaaggtt
ccggaaccagaagccatcccgccaaatatcctgtcctatctggtaacaggaatttctgtg
aattgtgcttatacatcaaaaatattgccaccggagaaagagggtggattacctcgtcat
gtggggaataaaacagaatgtgccttgttgggatttctcttggatttaaagcgggattat
caagatgtcagaaatgaaataccagaagaagcattgtacaaagtctataccttcaattct
gttaggaaatccatgagtacagtcctaaagaattcagatggaagtttccggatcttcagc
aagggtgcatctgagataattctgaaaaagtgtttcaaaatcttgagtgctaatggtgag
gccaaagtgttccgacccagagaccgagatgacattgtgaagacggtgattgagcccatg
gcatccgaaggcctgagaaccatatgcctagcgttcagagacttccccgcaggagagcca
gaaccagagtgggataacgagaacgatgtcgtcaccggccttacttgcatcgctgttgtg
gggattgaagatcctgtgaggcctgaggtaccagaggcaataaagaaatgtcagagggct
ggaattaccgtgcgcatggtcactggtgataatattaacacagctcgggccattgctacc
aaatgcggtattttacacccaggggaagatttcctgtgcttagaaggtaaagattttaac
cgaagaatacgaaatgaaaaaggagagattgaacaagagaggatagacaagatttggcca
aagcttcgagtgcttgcaagatcatctcccactgacaaacatacactggttaaaggtata
attgacagcacagtctcagagcaacgccaggttgtagctgtgacaggggatggtacaaat
gacgggcctgcgctgaagaaagcagacgttggctttgcaatgggcattgctggaactgat
gtggctaaagaagcatctgatatcattctcacagatgacaacttcacaagcattgttaaa
gcggttatgtggggacggaatgtctatgacagcatctcaaaattccttcagttccagctt
actgttaatgtagtggccgtgattgtcgctttcacgggcgcttgtattactcaagactcg
ccactgaaggcggtacagatgctctgggtcaacctcatcatggacacgctggcctccctg
gctctggcgacagaaccacccaccgagtcactcctgctccggaagccttacgggagaaac
aagcctctcatctcacgcacaatgatgaagaatatcttgggccatgcgttctatcagctc
gtagtggtcttcacgctcttgttcgctggagagaagtttttcgatatcgacagtgggagg
aacgcccctctgcatgctccaccgtcagagcactacaccattgtgttcaacacctttgtg
ctgatgcagctcttcaatgaaataaatgcccggaaaattcatggggaaagaaatgtgttt
gaagggatcttcaacaacgccatcttctgcacaattgtcttaggcacctttgtggtgcag
ataataatcgtgcagtttggcgggaagcctttcagctgctcagaactttcaatagaacaa
tggctgtggtccatattcctgggaatggggaccttactctggggccagcttatttcaacc
attccaaccagccgcttaaagtttctaaaagaagctggccatgggacacagaaggaagag
atccctgaggaggaattggcggaggatgttgaagagattgaccatgccgaacgggagttg
cggcgtggccagatcttgtggtttagaggcctgaacagaatccaaacacagatggatgta
gtgaatgctttccagagtggaggttccattcagggggctctaaggcgacaaccctccatc
gccagccagcaccatgatgtaacaaatgtttctacccctacacatgtagtgttttcctct
tctactgcttctactcctgtggggtatccgagtggtgaatgcatttcgtag

KEGG   Rattus norvegicus (rat): 29599
Entry
29599             CDS       T01003                                 

Gene name
Atp2b3
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 3
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04925  Aldosterone synthesis and secretion
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29599 (Atp2b3)
   04024 cAMP signaling pathway
    29599 (Atp2b3)
   04022 cGMP-PKG signaling pathway
    29599 (Atp2b3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    29599 (Atp2b3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29599 (Atp2b3)
  09154 Digestive system
   04970 Salivary secretion
    29599 (Atp2b3)
   04972 Pancreatic secretion
    29599 (Atp2b3)
   04978 Mineral absorption
    29599 (Atp2b3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29599 (Atp2b3)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     29599 (Atp2b3)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Cation_ATPase_N Hydrolase ATP_Ca_trans_C Hydrolase_3
Other DBs
NCBI-GeneID: 29599
NCBI-ProteinID: NP_579822
RGD: 621304
Ensembl: ENSRNOG00000061304
UniProt: Q64568
Position
X
AA seq 1159 aa
MGDMANSSIEFHPKPQQQREVPHVGGFGCTLAELRSLMELRGAEALQKIQEAYGDVSGLC
RRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKTFLQLVWEALQDVTLIILEVAAIV
SLGLSFYAPPGEESEACGNVSGGAEDEGEAEAGWIEGAAILLSVICVVLVTAFNDWSKEK
QFRGLQSRIEQEQKFTVIRNGQLLQVPVAALVVGDIAQVKYGDLLPADGVLIQGNDLKID
ESSLTGESDHVRKSADKDPMLLSGTHVMEGSGRMVVTAVGVNSQTGIIFTLLGAGGEEEE
KKDKKAKKQDGAVAMEMQPLKSAEGGEMEEREKKKANVPKKEKSVLQGKLTKLAVQIGKA
GLVMSAITVIILVLYFVIETFVVDGRVWLAECTPVYVQYFVKFFIIGVTVLVVAVPEGLP
LAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYLGDTH
YKEIPAPSALTPKILDLLVHAISINSAYTTKILPPEKEGALPRQVGNKTECALLGFILDL
KRDFQPVREQIPEDQLYKVYTFNSVRKSMSTVIRMPDGGFRLFSKGASEILLKKCTNILN
SNGELRGFRPRDRDDMVKKIIEPMACDGLRTICIAYRDFSAIQEPDWDNENEVVGDLTCI
AVVGIEDPVRPEVPEAIRKCQRAGITVRMVTGDNINTARAIAAKCGIIQPGEDFLCLEGK
EFNRRIRNEKGEIEQERLDKVWPKLRVLARSSPTDKHTLVKGIIDSTTGEQRQVVAVTGD
GTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQ
FQLTVNVVAVIVAFTGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTESLLLRKPY
GRDKPLISRTMMKNILGHAVYQLTIIFTLLFVGELFFDIDSGRNAPLHSPPSEHYTIIFN
TFVMMQLFNEINARKIHGERNVFDGIFSNPIFCTIVLGTFGIQIVIVQFGGKPFSCSPLS
TEQWLWCLFVGVGELVWGQVIATIPTSQLKCLKEAGHGPGKDEMTDEELAEGEEEIDHAE
RELRRGQILWFRGLNRIQTQMEVVSTFKRSGSFQGAVRRRSSVLSQLHDVTNLSTPTHVT
LSAAKPTSAAGNPSGESIP
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgggtgacatggcgaacagttccattgagttccaccccaaaccccagcagcagcgggaa
gtgcctcatgtgggtggctttggatgcacgctggcagaactacgcagcctcatggagctc
cgaggtgctgaggcactgcagaagatccaagaagcctatggggatgtcagtgggctgtgt
aggagactaaagacctcacctactgaaggcctggcagacaacaccaatgacttggagaaa
cgcaggcagatctatgggcagaacttcatccctccaaagcagcccaagaccttcctgcag
ctggtgtgggaagccctgcaggacgtgactctcatcatcctggaggtggctgctatcgtc
tccctgggcctctccttctatgcaccacctggagaggaaagtgaagcctgtgggaatgtg
tctggtggggcagaagacgaaggagaggccgaggctggctggatagagggggctgccatc
ctactctctgtcatctgtgtggtgctggtcacagccttcaatgactggagcaaggaaaag
cagttccgaggtcttcagagccgaattgagcaggaacagaagtttactgtcatccgaaat
gggcagctcctccaggtccctgtggcagccctggtggtaggggacattgcccaggtcaaa
tacggagatcttctgcctgccgatggtgtgctcatccaaggcaatgacctcaagatcgac
gagagctccctgaccggcgagtcggaccatgtgcgcaaatcagcagacaaagatcctatg
ctgctctcaggcactcatgtcatggaaggttctggaagaatggtagtaacagctgttggt
gtgaactcccagacaggcatcatctttacattgcttggggcaggtggagaggaggaggag
aagaaagacaagaaagctaagaagcaggatggggctgttgccatggaaatgcagcccctg
aagagtgccgagggtggggaaatggaggagcgggaaaagaagaaagccaacgtacccaag
aaggagaagtcagtcctgcaagggaagctcacaaaactggctgtgcagattgggaaagca
ggattggtgatgtctgctatcactgtcatcattctggtcctctactttgtgattgagacc
ttcgttgtggatggccgggtgtggctggcagagtgcacaccagtgtatgtgcagtacttt
gtgaagtttttcattattggagtcactgtgttggttgtggctgtccctgagggcctgcct
cttgctgttactatctccttggcttactctgttaagaaaatgatgaaggacaataacctg
gtacgccacctggatgcctgtgagaccatgggcaatgccacagccatctgttctgacaag
acaggcacactcaccaccaaccgtatgacagtggttcagtcctacctaggagacacccac
tacaaagagattccagctcccagcgccctgacccccaagatcctcgaccttctggttcat
gccatctccatcaacagtgcctacaccaccaaaattctacctccagagaaagaaggcgct
ctcccacgccaagtgggcaacaaaacagagtgtgctcttttgggcttcatcttggacctg
aaacgtgacttccaacctgtacgggaacagataccagaagatcagctttacaaagtgtac
accttcaactcagttcgcaagtccatgagcacagttatccgaatgcctgatggtggcttc
cgcctcttcagcaagggagcctcagagatcctgctcaaaaagtgtacaaacatcttaaac
agcaatggtgaactccgaggatttcgtcctcgggaccgggatgacatggtaaagaagatc
attgagcctatggcttgtgatggcctccgcaccatatgcatcgcctacagggacttctct
gctatccaggaaccggactgggacaatgagaatgaggtggtgggtgaccttacctgcata
gctgtcgtgggcatcgaggaccctgtgcgacctgaggtccctgaagccattcgaaaatgc
cagcgtgctggcattacagtccgtatggtaactggagataacatcaacactgcccgggct
attgcagctaagtgtggcatcatccagccaggggaggatttcctgtgcctggaggggaag
gaattcaacagaaggattcgaaatgagaaaggcgagatagaacaggagaggctggacaag
gtgtggcccaagcttcgggtgcttgcccggtcatctcccactgataaacatactctggtc
aaaggcataattgacagcacaaccggtgagcagcggcaggtggtggctgtgaccggggat
ggcaccaatgatggaccagccctcaaaaaggcagatgtgggcttcgccatgggcatcgca
ggcactgatgtggccaaggaggcctctgacatcattctgactgatgacaacttcaccagc
attgtcaaggcggtcatgtggggccgcaatgtctatgacagcatttccaagttcctgcag
tttcagttgacagtcaatgtggtagctgtgatcgtggccttcacgggtgcctgcattact
caggactctcctctcaaagctgtgcagatgttgtgggtgaacttgatcatggacacattt
gcctcacttgccctggcaacggaacccccaactgagtcactgctgctgcggaagccatat
ggccgggacaagcctctcatctcacgcaccatgatgaagaacatccttggacatgctgtt
taccagcttaccatcatctttactctgctatttgttggagagcttttctttgacattgac
agtggaaggaatgcacctctgcactcgccgccctcagagcactacaccatcatcttcaac
acatttgtcatgatgcagcttttcaatgagatcaatgctcgaaagatccatggtgagagg
aatgtctttgatggcatcttcagcaaccccatcttctgtaccattgtcctgggcaccttt
ggaattcagattgtcattgtccaatttggagggaagcccttcagctgttccccactgtcc
acagaacagtggctctggtgtctttttgttggtgttggggagctggtctggggacaggtc
attgccactatccccaccagccagctcaagtgcctgaaggaagcagggcatgggcctggg
aaggatgagatgactgatgaagagttggcggaaggggaagaagaaattgaccatgctgag
cgagagctccgcagaggccagatcctctggtttcggggcctcaaccggatccagacacag
atggaggtagtgagtaccttcaagagaagcgggtcatttcagggtgctgtgcgccggcgg
tcttcggtcctcagccagctccatgacgtaaccaatctttctacccctactcacgtaact
ctctctgccgccaagcccaccagcgctgctggcaatccgagtggtgaaagcattccgtag

KEGG   Rattus norvegicus (rat): 29600
Entry
29600             CDS       T01003                                 

Gene name
Atp2b4
Definition
(RefSeq) plasma membrane calcium-transporting ATPase 4
  KO
K05850  P-type Ca2+ transporter type 2B [EC:7.2.2.10]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04925  Aldosterone synthesis and secretion
rno04961  Endocrine and other factor-regulated calcium reabsorption
rno04970  Salivary secretion
rno04972  Pancreatic secretion
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    29600 (Atp2b4)
   04024 cAMP signaling pathway
    29600 (Atp2b4)
   04022 cGMP-PKG signaling pathway
    29600 (Atp2b4)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    29600 (Atp2b4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29600 (Atp2b4)
  09154 Digestive system
   04970 Salivary secretion
    29600 (Atp2b4)
   04972 Pancreatic secretion
    29600 (Atp2b4)
   04978 Mineral absorption
    29600 (Atp2b4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    29600 (Atp2b4)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     29600 (Atp2b4)
SSDB
Motif
Pfam: Cation_ATPase_C E1-E2_ATPase Cation_ATPase Cation_ATPase_N ATP_Ca_trans_C Hydrolase Hydrolase_3
Other DBs
NCBI-GeneID: 29600
NCBI-ProteinID: NP_001005871
RGD: 621305
Ensembl: ENSRNOG00000003031
UniProt: Q64542
Position
13
AA seq 1169 aa
MTNPSGHNLPANSVAESYEGEFGCTLMDLRKLMELRAADAVTQISAHYGSVQEICARLKT
SPVEGLSGNPADLEKRRLVFGKNMIPPKKPKTFLELVWEALQDVTLIILEIAAIISLVLS
FYRPPGGENEICGHIVSNPEEDEEGETGWIEGAAILASVIIVVFVTAFNDWSKEKQFRGL
QSRIELEQKFSIIRNGQLIQLPVAEIVVGDIAQVKYGDLLPADGILIQGNDLKIDESSLT
GESDHVKKTLDKDPMLLSGTHVMEGSGRMVVTAVGINSQTGIIFTLLGANEEEDDEKKKK
GKKQGVSENRNKAKTQDGVALEIQPLNSQEGLDSEEKEKKASKGPKKEKSVLQGKLTRLA
VQIGKAGLIMSILTVLILILYFVVDNFVIQRRAWLPECTPVYIQYFVKFFIIGVTVLVVA
VPEGLPLAVTISLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTMNRMTVVQA
YIGGTHYRQIPKPDDLPPNVLDLIVNSICINSAYTSKILPPEKEGGLPRQVGNKTECGLL
GFVTDLKQDYQAVRSEMPEEKLFKVYTFNSVRKSMSTVIRKPEGGFRVFSKGASEIMLRK
CDRILNKEGGIVPFKTKDRDNMVRNVIEPMASEGLRTIGIAYRDFDGEEPSWENENEIFT
GLVCIAVVGIEDPVRPEVPDAINKCKRAGITVRMVTGDNVNTARAIATKCGILTPGDDFL
CLEGKEFNRLIRNEKGEVEQEKLDKVWPRLRVLARSSPTDKHTLVKGIIDSNIGEQRQVV
AVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSI
SKFLQFQLTVNVVAVIVAFSGACITQDSPLKAVQMLWVNLIMDTFASLALATEPPTDSLL
RRRPYGRNKPLISRTMMKNILGHAVYQLGIVFLLVFAGDKLFDIDSGRKAPLNSPPSQHY
TIVFNTFVLMQLFNEINSRKIHGEKNVFAGVYRNIIFCSVVLGTFFCQILIVEVGGKPFS
CTNLTMEQWMWCLFIGIGELLWGQVISAIPTKSLKFLKEAGHGSDKEEISKDAEGLEEID
HAEMELRRGQILWVRGLNRIQTQIEVINKFQTGASFKGVLRRQNLSQQLDVKLVPSSYSE
AVASVRTSPSTSSAVTPPPVGNQSGQSIS
NT seq 3510 nt   +upstreamnt  +downstreamnt
atgacgaatccatcaggacataacttgccagccaactcggtagctgagagctatgaaggg
gagtttggctgcaccttaatggacctgaggaagctcatggagcttcgtgcagctgatgca
gtgacccagatcagtgcccactatggaagtgtacaagaaatctgcgcaagactgaaaacc
tcccctgtagaaggtctgtctgggaaccctgcagatttggagaagcgtagacttgttttt
gggaagaacatgatacctccgaaaaagcccaagacgttcttagaattagtgtgggaagcc
ctgcaggatgtcacactcatcatcctggagatcgcagccatcatatccctggtcctgtcc
ttctaccggcctcctggcggggaaaatgaaatctgtggccacattgtaagtaacccagaa
gaagatgaggaaggagaaactggctggattgaaggggcagccattcttgcctcggtgatc
attgtggtattcgtgacagccttcaacgactggagcaaagagaagcagttccgggggctg
cagagtcgcattgagcttgagcaaaaattctccattatccggaatggtcagcttatacaa
ctcccagtggctgagattgtggtgggagatattgcccaggtcaaatacggtgacctgctg
cctgccgacggaatcctaatccagggaaatgatctgaagattgacgagagctctttgaca
ggagaatcagatcatgtcaagaagactctggacaaagaccccatgttgctctcagggact
catgtgatggaaggctctggacggatggtggtgactgctgtgggaatcaattcccagact
ggaatcatcttcaccctcttaggggctaatgaggaagaagacgatgagaaaaagaagaaa
ggtaaaaaacaaggagtctctgaaaatcgcaacaaagcaaaaacccaggatggagtggcc
ttggaaatccagccactcaacagccaggaggggctcgatagtgaggaaaaggagaagaaa
gcaagcaagggacccaagaaggagaagtcggtcctgcagggcaagctcacacgcctggct
gtgcagatcgggaaggcaggtctgatcatgtctatcctcacagtcctcatcctgattcta
tacttcgtggttgacaatttcgtgatacagcgccgggcatggcttcctgagtgcactcct
gtgtacatccagtattttgtcaagttcttcatcatcggagtcactgtactggtagtggct
gtgccagaggggctgccactggctgtcaccatctcgttggcctactctgtaaagaaaatg
atgaaggacaacaacttggtccggcacttggacgcctgtgagacgatgggcaacgccaca
gccatctgctctgataagacgggcacgctgaccatgaaccgcatgaccgtggtacaagct
tacattgggggcactcactaccgccagatcccaaaacctgacgacctcccacccaacgtt
ctggacctcatagtcaacagcatctgtatcaactctgcttacacttctaagattctgcct
ccagagaaagagggaggcctcccccggcaagtaggcaacaagacagagtgtggactgctg
ggctttgtcacagacctgaagcaggactaccaagcagttcgcagtgagatgcccgaggag
aagctcttcaaggtgtacaccttcaactcagtgcgcaagtccatgagcaccgtcatcagg
aagccggaagggggcttccgcgtgttcagcaagggcgcctccgagataatgctgcgcaag
tgtgatcggatcctgaacaaggaaggaggaattgtaccattcaaaactaaggaccgagac
aatatggtacgcaacgtcattgagcccatggccagtgaaggactccggaccatcggcata
gcttaccgagattttgatggtgaagagccctcgtgggaaaatgagaatgagatcttcact
gggctggtctgcattgcagtggtgggcattgaggaccctgtgcgcccagaggtaccagat
gccattaacaagtgcaaacgggctggcattactgtcaggatggtgacaggtgacaacgtc
aacacagccagggccatcgccaccaaatgtggcatcttgactcctggtgatgacttcctg
tgtctggaagggaaagaattcaacagactcatacgcaatgagaagggcgaggtcgaacaa
gaaaagctggacaaggtctggcccaggcttcgggtactggcacgatcttctcccacagac
aagcacacattggtgaaaggtatcattgacagcaatattggggaacagaggcaggtggtg
gctgtcaccggtgatggaaccaatgatggaccggctctaaagaaagcagatgtcggtttt
gctatgggcattgcaggcacagatgtggctaaggaggcatcagacatcatcctgactgat
gacaacttcaccagcattgtgaaggcagtgatgtggggccggaacgtatacgacagcatt
tccaagttcctgcagttccagctcactgtcaacgtggtggccgtgattgtggctttctct
ggagcctgcatcactcaggattccccactgaaagcggtgcagatgctgtgggtgaacctg
atcatggacacgtttgcttctctggccctggccacagagcccccgaccgattccctgctg
aggcgtcgcccctatgggcgaaacaagcccctgatctctcgcacaatgatgaagaacatc
ctgggccacgcggtgtatcagctcggaatcgtcttcctcctcgtctttgctggcgacaaa
ctgtttgacattgacagtgggaggaaggcgcctctcaattcaccacccagccagcactac
accattgttttcaacacgtttgtgctgatgcaactcttcaacgagatcaactctcggaag
atccatggcgagaagaatgtctttgcaggtgtctaccgcaacatcattttctgctctgtt
gttttaggcacgttcttctgccagatcttgatcgtggaagtgggaggtaagcccttcagc
tgcacaaacctcaccatggagcagtggatgtggtgtctctttatagggatcggagaactt
ttgtggggccaggtcatctctgcaatacctaccaagtctctaaagttcctgaaagaggcg
ggccatggcagtgacaaagaggagatcagcaaggacgctgaggggctggaagagatcgac
catgccgagatggagcttcgccgaggccagatcctctgggtccgtggcctgaaccggatt
cagactcagattgaagtaattaacaaattccagacgggagcctcttttaagggagtccta
aggcgacagaacttgagtcaacaacttgatgtaaaactggttcctagctcctattcagaa
gcagttgcgtcagtcagaacctccccctccacctcttctgccgttacacctcctcctgtg
ggcaatcagagtggtcaaagtatttcatag

DBGET integrated database retrieval system