KEGG   Rattus norvegicus (rat): 24217
Entry
24217             CDS       T01003                                 

Gene name
Atp4b, S76401S1
Definition
(RefSeq) ATPase H+/K+ transporting beta subunit
  KO
K01543  H+/K+-exchanging ATPase subunit beta [EC:7.2.2.19]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04966  Collecting duct acid secretion
rno04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    24217 (Atp4b)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    24217 (Atp4b)
  09155 Excretory system
   04966 Collecting duct acid secretion
    24217 (Atp4b)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.19  H+/K+-exchanging ATPase
     24217 (Atp4b)
SSDB
Motif
Pfam: Na_K-ATPase
Other DBs
NCBI-GeneID: 24217
NCBI-ProteinID: NP_036642
RGD: 2178
Ensembl: ENSRNOG00000018543
UniProt: P18598
Position
16q12.5
AA seq 294 aa
MAALQEKKSCSQRMAEFRQYCWNPDTGQMLGRTPARWVWISLYYAAFYVVMTGLFALCIY
VLMQTIDPYTPDYQDQLKSPGVTLRPDVYGERGLQISYNISENSSWAGLTHTLHSFLAGY
TPASQQDSINCSSEKYFFQETFSAPNHTKFSCKFTADMLQNCSGLVDPSFGFEEGKPCFI
IKMNRIVKFLPSNNTAPRVDCTFQDDPQKPRKDIEPLQVQYYPPNGTFSLHYFPYYGKKA
QPHYSNPLVAAKFLNVPKNTQVLIVCKIMADHVTFDNPHDPYEGKVEFKLTIQK
NT seq 885 nt   +upstreamnt  +downstreamnt
atggcagccctgcaggagaagaagtcatgcagccagcgcatggccgaattccggcaatac
tgttggaacccggacactgggcagatgctgggccgcaccccagcccggtgggtgtggatc
agcctgtactatgcagctttctacgtggtcatgactgggctctttgccttgtgcatctat
gtgctgatgcagaccattgatccctacacccccgactaccaggaccagttaaagtcaccg
ggggtaaccttgagaccggatgtgtatggggaaagagggctgcagatttcctacaacatc
tctgaaaacagctcctgggctggcctcacacacaccctccacagcttcttagcgggctac
accccagcatcccagcaggacagcatcaactgttcgtctgaaaagtacttcttccaggag
accttttctgctccgaaccataccaagttctcctgcaagttcacggcggacatgctacag
aattgctcaggcctggtggaccccagtttcggctttgaggagggaaagccctgcttcatt
attaaaatgaacaggattgtcaagttcctgcccagcaacaacacggctccccgagtggac
tgcaccttccaggatgacccccaaaagccccggaaggacattgaacccctgcaggtccag
tactatccccccaatggtaccttcagtctccactacttcccctactacggcaagaaagca
cagccccactacagcaaccctctggtggcggcaaagttcctcaacgtccccaaaaacacg
caagtcctcatcgtgtgcaagatcatggcggaccacgtgaccttcgacaacccccacgac
ccctatgaagggaaggtggagttcaagctcacaatacagaagtaa

DBGET integrated database retrieval system