KEGG   Rattus norvegicus (rat): 24218
Entry
24218             CDS       T01003                                 

Gene name
Atp7b, Hts, PINA, Wd
Definition
(RefSeq) ATPase copper transporting beta
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    24218 (Atp7b)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    24218 (Atp7b)
Enzymes [BR:rno01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     24218 (Atp7b)
SSDB
Motif
Pfam: HMA Hydrolase E1-E2_ATPase Hydrolase_3 RRM_3 Hydrolase_6 HAD_2 HAD
Other DBs
NCBI-GeneID: 24218
NCBI-ProteinID: NP_036643
RGD: 2180
Ensembl: ENSRNOG00000012878
UniProt: Q9QUG4
Position
16q12.5
AA seq 1452 aa
MPEQERKVTAKEASRKILSKLALPTRPWGQSMKQSFAFDNVGYEGGLDSTCSSSTTTGVV
SILGMTCHSCVKSIEDRISSLKGIVSIKVSLEQGSATVKYVPSVLNLQQICLQIEDMGFE
ASAAEGKAASWPSRSSPAQEAVVKLRVEGMTCQSCVSSIEGKIRKLQGVVRVKVSLSNQE
AVITYQPYLIQPEDLRDHICDMGFEAAIKNRTAPLRLGPIDINKLESTNLKRAAVPPIQN
SNHLETPGHQQNHLATLPLRIDGMHCKSCVLNIEGNIGQLPGVQNIHVSLENKTAQVQYD
SSCITPLFLQTAIEALPPGYFKVSLPDGLEKESGSSSVPSLGSSQRQQEPGPCRTAVLTI
TGIPRDSSVQPMEDMLSQMKGVQQIDISLAEGTGAVLYDPSVVSSDELRTAVEDMGFEVS
VNPENITTNRVSSGNSVPQAVGDSPGSVQNMASDTRGLLTHQGPGYLSDSPPSPGGTASQ
KCFVQIKGMTCASCVSNIERSLQRHAGILSVLVALMSGKAEVKYDPEVIQSPRIAQLIED
LGFEAAIMEDNTVSEGDIELIITGMTCASCVHNIESKLTRTNGITYASVALATSKAHVKF
DPEIIGPRDIIKVIEEIGFHASLAHRNPNAHHLDHKTEIKQWKKSFLCSLVFGIPVMGLM
IYMLIPSSKPHETMVLDHNIIPGLSVLNLIFFILCTFVQFLGGWYFYVQAYKSLRHKSAN
MDVLIVLATTIAYAYSLVILVVAIAEKAEKSPVTFFDTPPMLFVFIALGRWLEHVAKSKT
SEALAKLMSLQATEATVVTLGEDNLILREEQVPMELVQRGDIIKVVPGGKFPVDGKVLEG
NTMADESLITGEAMPVTKKPGSIVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQM
SKAPIQQLADRFSGYFVPFIIIISTLTLVVWIIIGFVDFGIVQKYFPSPSKHISQTEVII
RFAFQTSITVLCIACPCSLGLATPTAVMVGTGVAAQNGVLIKGGKPLEMAHKIKTVMFDK
TGTITHGVPRVMRFLLLVDVATLSLRKVLAVVGTAEASSEHPLGVAVTKYCKEELGTETL
GYSTDFQAVPGCGISCKVSNVESILAHRGPTAHPIGVGNPPIGEGTGPQTFSVLIGNREW
MRRNGLTISSDISDAMTDHEMKGQTAILVAIDGVLCGMIAIADAVKPEAALAIYTLKSMG
VDVALITGDNRKTARAIATQVGINKVFAEVLPSHKVAKVQELQNKGKKVAMVGDGVNDSP
ALAQADVGIAIGTGTDVAIEAADVVLIRNDLLDVVASIHLSKRTVRRIRVNLVLALIYNM
VGIPIAAGVFMPIGIVLQPWMGSAAMAASSVSVVLSSLQLKCYRKPDLERYEAQAHGRMK
PLSASQVSVHVGMDDRRRDSPRATPWDQVSYVSQVSLSSLTSDRLSRHGGMAEDGGDKWS
LLLSDRDEEQCI
NT seq 4359 nt   +upstreamnt  +downstreamnt
atgcctgaacaggagagaaaggtcacagccaaagaggccagtcggaaaatcttatctaaa
cttgctttgcccacacgaccgtggggacaatcaatgaagcagagcttcgccttcgataat
gttggctatgaagggggcctggacagcacctgctcatcctcaactaccaccggtgtggtt
agcatcctgggcatgacttgtcattcttgcgtcaagtccatcgaggacaggatctccagt
ctgaaaggcattgtgagcatcaaggtttctctggagcagggcagcgccactgtcaaatat
gtaccgtcagtcttgaacctgcagcagatttgccttcagattgaggacatgggctttgag
gccagcgctgcagaaggaaaggctgcctcctggccttccaggtcttccccagcccaggag
gcagtggtcaagctccgggtagagggcatgacctgtcagtcctgtgtcagctccatcgaa
ggcaagatccggaagctgcaaggggttgtgagagtcaaagtctccctaagcaaccaagag
gcagtcattacatatcagccttacctcattcaacccgaagacctcagggaccacatctgc
gacatgggattcgaagctgccatcaagaacagaacagctcccttaaggctgggaccaatt
gatatcaacaagttagaaagcactaacctaaagagagcagcagtccctcctatccagaat
tccaatcatttggagaccccggggcaccagcagaaccacctggccaccctcccactaaga
atagacgggatgcactgtaaatcatgtgttttgaatatcgaaggaaatataggccaactt
ccaggggttcaaaatattcatgtgtccttggagaacaaaaccgcccaagtacagtatgac
tcttcttgtatcacccccttgttcctacagacagccatcgaggcactaccacctgggtac
tttaaagtatcccttcccgatggcctagagaaggagagtggatcttccagtgtcccctcc
cttggctcctcccagagacagcaggagccaggcccatgcaggactgcggtactcaccatc
actggcattccccgtgactcgtctgttcagcccatggaagacatgctgtcccagatgaag
ggtgtgcagcaaatagacatctctttggcagaggggactggagcagttctttacgatccc
tcagtagttagctcggatgaactccggacggctgtagaagacatgggctttgaggtgtca
gtgaatcccgaaaacattactactaaccgtgtcagctctgggaattctgtgccacaagcc
gtgggtgattcaccagggtctgtgcaaaatatggcttctgacactagaggactcctcaca
caccaaggccctggctacttgtcagacagcccaccatcccctggaggaacagcatcacag
aagtgctttgtacagatcaaaggcatgacctgtgcgtcctgtgtgtctaacatagaaagg
agtctgcagagacatgccggtattctctccgtgttggtcgccttgatgtcgggaaaggca
gaggtcaagtatgacccagaggtcatccagtctcccaggatagctcagctcatcgaggac
ctgggcttcgaagcagcaatcatggaggacaacacagtctctgaaggtgacatcgaactg
attatcacagggatgacctgcgcttcctgtgttcacaacatagaatctaagctcacaagg
acaaatggcatcacttacgcctctgtggccctcgccaccagcaaagcccatgtgaagttt
gaccctgaaatcattggtccacgtgacatcatcaaggtcatcgaggaaatcggctttcat
gcttccctggcccacagaaaccccaacgctcatcacttggaccacaagacggaaataaaa
cagtggaagaaatctttcctgtgcagcctggtgtttggcatccccgtcatgggcttgatg
atctacatgctaatccccagcagtaagccccacgagaccatggtcctggaccacaacatc
attccaggactgtccgttctaaacctcattttcttcatcttgtgtaccttcgtccaattc
ctgggtgggtggtacttctatgtccaagcctacaaatcgctgagacacaagtcagccaac
atggatgtgctcatcgtactcgccacgaccattgcctatgcctactccctggtcatcctg
gtggttgccatagctgaaaaggcggagaagagcccagtgaccttctttgacacacccccc
atgctcttcgtcttcatcgccctgggacggtggctggagcacgtggcaaagagcaaaact
tcagaagccctcgcaaaactcatgtcactccaagccacagaagccacagttgtgaccctg
ggagaggacaacttaatcctcagagaggagcaagtgcccatggagctggtgcagcgaggt
gacatcatcaaggttgtccctgggggcaagttcccagtggacgggaaagtcctggaaggc
aacaccatggcagatgagtccctcatcacaggagaggccatgcctgtcaccaagaaaccc
gggagcatagtgattgctggctctataaatgctcatggctctgtgctcattaaagctacc
catgtgggcaatgacactactttggctcagattgtcaagttggtggaagaggcccagatg
tcaaaggctcccattcagcagctggctgaccggttcagtggatatttcgtcccatttatc
atcattatttcaaccttaacattggtggtgtggatcatcatcggctttgtcgattttggt
attgttcagaagtactttcctagccctagcaagcatatctcacagacagaggtgatcatc
cgctttgccttccagacgtccatcaccgtcctgtgcatcgcctgcccctgctccctcggg
ctggccacacccacagcagttatggtgggcactggggtggctgcccagaacggcgtccta
atcaagggagggaagcctctggagatggcacacaagataaagaccgttatgtttgacaaa
acgggcaccattacccacggggtccccagagtcatgcggtttctgctgcttgtggacgtg
gctaccctatccctcaggaaggttctggctgtggtgggcaccgcagaggccagcagtgag
caccccttaggcgtggccgtcactaaatactgcaaagaggaactcgggacggagaccctg
gggtacagcacggacttccaggcagtgccagggtgtggaattagctgcaaagttagcaac
gtggaaagtatcctggctcacagaggtccaaccgctcacccgattggggttggcaaccct
cccataggagaaggtacaggtccccagactttctctgtgctgattggaaaccgggaatgg
atgaggcgcaatggtttaaccatctccagtgacatcagtgacgccatgacagatcatgaa
atgaaaggacagacggccatcctggtggccattgatggtgtgctgtgcgggatgatcgcc
attgcagatgctgttaaaccagaggctgccctggctatctacaccctgaaaagcatgggc
gtggatgtggctctgatcacaggggacaaccggaagacagccagagccattgccactcag
gttggcatcaacaaagtctttgctgaggtactgccttctcacaaggtggccaaggtccag
gagcttcagaacaaagggaaaaaagtcgccatggtgggagacggggtgaacgactcccca
gccttggcccaggctgacgtgggcattgctattgggactgggacagatgtcgccatcgaa
gcagccgacgtggtccttataagaaatgacttactggacgtggtggccagcattcatctc
tccaagaggaccgtccggaggatccgggtcaatctggtgctggcgttgatttataacatg
gttgggatacccattgctgcaggtgtcttcatgcccattggcatcgtgctgcagccatgg
atgggctcagcggccatggccgcctcctctgtgtccgtggtgctctcctctcttcagctc
aagtgctacagaaagcccgacctagagagatatgaggcacaggcccatggacgcatgaag
cctctgagtgcatcccaagtcagcgtgcacgttggcatggatgaccggcggcgggattct
cccagggccacaccctgggaccaggtcagctacgtgagccaagtctctctgtcttccctg
acgtcagacagattgtctcggcatggcggtatggcagaggatggtggagacaaatggtcc
ctgctcctgagtgacagggatgaagagcagtgcatctga

DBGET integrated database retrieval system