KEGG   Rattus norvegicus (rat): 24221Help
Entry
24221             CDS       T01003                                 

Gene name
Avp, DI, VP, Vas
Definition
(RefSeq) arginine vasopressin
  KO
K05242  arginine vasopressin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    24221 (Avp)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24221 (Avp)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24221 (Avp)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    24221 (Avp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_5 Hormone_4
Motif
Other DBs
NCBI-GeneID: 24221
NCBI-ProteinID: NP_058688
RGD: 2184
Ensembl: ENSRNOG00000021229
UniProt: P01186
Position
3q36
AA seq 168 aa AA seqDB search
MLAMMLNTTLSACFLSLLALTSACYFQNCPRGGKRATSDMELRQCLPCGPGGKGRCFGPS
ICCADELGCFLGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSDESCVAEPEC
REGFFRLTRAREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctcgccatgatgctcaacactacgctctctgcttgcttcctgagcctgctggccctc
acctctgcctgctacttccagaactgcccaagaggaggcaagagggccacatccgacatg
gagctgagacagtgtctcccctgcggccctggcggcaaagggcgctgcttcgggccgagc
atctgctgcgcggacgagctgggctgcttcctgggcaccgccgaggcgctgcgctgccag
gaggagaactacctgccctcgccctgccagtctggccagaagccttgcggaagcggaggc
cgctgcgctgccgcgggcatctgctgcagcgatgagagctgcgtggccgagcccgagtgt
cgagagggttttttccgcctcacccgcgctcgggagcagagcaacgccacgcagctggac
gggccagcccgggagctgctgcttaggctggtacagctggctgggacacaagagtccgtg
gattctgccaagccccgggtctactga

DBGET integrated database retrieval system