KEGG   Rattus norvegicus (rat): 24223
Entry
24223             CDS       T01003                                 

Gene name
B2m
Definition
(RefSeq) beta-2-microglobulin precursor
  KO
K08055  beta-2-microglobulin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04612  Antigen processing and presentation
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    24223 (B2m)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24223 (B2m)
   05170 Human immunodeficiency virus 1 infection
    24223 (B2m)
   05168 Herpes simplex virus 1 infection
    24223 (B2m)
   05163 Human cytomegalovirus infection
    24223 (B2m)
   05169 Epstein-Barr virus infection
    24223 (B2m)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24223 (B2m)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   24223 (B2m)
SSDB
Motif
Pfam: C1-set Ig_3 I-set
Other DBs
NCBI-GeneID: 24223
NCBI-ProteinID: NP_036644
RGD: 2189
Ensembl: ENSRNOG00000017123
UniProt: P07151
Structure
PDB: 

Position
3
AA seq 119 aa
MARSVTVIFLVLVSLAVVLAIQKTPQIQVYSRHPPENGKPNFLNCYVSQFHPPQIEIELL
KNGKKIPNIEMSDLSFSKDWSFYILAHTEFTPTETDVYACRVKHVTLKEPKTVTWDRDM
NT seq 360 nt   +upstreamnt  +downstreamnt
atggctcgctcggtgaccgtgatctttctggtgcttgtctctctggccgtcgtgcttgcc
attcagaaaactccccaaattcaagtgtactctcgccatccaccggagaatgggaagccc
aacttcctcaactgctacgtgtctcagttccacccacctcaaatagaaattgagctactg
aagaatggaaagaagataccaaatatcgagatgtcagatctgtccttcagcaaggactgg
tctttctacatcctggctcacactgaattcacacccaccgagaccgatgtatatgcttgc
agagttaaacacgtcactctgaaggagcccaaaaccgtcacctgggaccgagacatgtaa

DBGET integrated database retrieval system