KEGG   Rattus norvegicus (rat): 24225
Entry
24225             CDS       T01003                                 

Gene name
Bdnf
Definition
(RefSeq) brain-derived neurotrophic factor isoform 3 preproprotein
  KO
K04355  brain-derived neurotrophic factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04024  cAMP signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04722  Neurotrophin signaling pathway
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24225 (Bdnf)
   04014 Ras signaling pathway
    24225 (Bdnf)
   04024 cAMP signaling pathway
    24225 (Bdnf)
   04151 PI3K-Akt signaling pathway
    24225 (Bdnf)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    24225 (Bdnf)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    24225 (Bdnf)
   05022 Pathways of neurodegeneration - multiple diseases
    24225 (Bdnf)
  09165 Substance dependence
   05030 Cocaine addiction
    24225 (Bdnf)
   05034 Alcoholism
    24225 (Bdnf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    24225 (Bdnf)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   24225 (Bdnf)
SSDB
Motif
Pfam: NGF NTF3_N Spaetzle
Other DBs
NCBI-GeneID: 24225
NCBI-ProteinID: NP_001257560
RGD: 2202
Ensembl: ENSRNOG00000047466
UniProt: P23363
Position
3
AA seq 249 aa
MTILFLTMVISYFGCMKAAPMKEANVHGQGNLAYPAVRTHGTLESVNGPRAGSRGLTTTS
LADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLD
AANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLK
QYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCV
CTLTIKRGR
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaccatccttttccttactatggttatttcatacttcggttgcatgaaggctgcgccc
atgaaagaagcaaacgtccacggacaaggcaacttggcctacccagctgtgcggacccat
gggactctggagagcgtgaatgggcccagggcaggttcgagaggtctgacgacgacgtcc
ctggctgacacttttgagcacgtgatcgaagagctgctggatgaggaccagaaggttcgg
cccaacgaagaaaaccataaggacgcggacttgtacacttcccgggtgatgctcagcagt
caagtgcctttggagcctcctctgctctttctgctggaggaatacaaaaattacctggat
gccgcaaacatgtctatgagggttcggcgccactccgaccccgcccgccgtggggagctg
agcgtgtgtgacagtattagcgagtgggtcacagcggcagataaaaagactgcagtggac
atgtccggtgggacggtcacagtcctggagaaagtcccggtatcaaaaggccaactgaag
caatatttctacgagaccaagtgtaatcccatgggttacacgaaggaaggctgcaggggc
atagacaaaaggcactggaactcgcaatgccgaactacccaatcgtatgttcgggccctt
actatggatagcaaaaagagaattggctggcggttcataaggatagacacttcctgtgta
tgtacactgaccattaaaaggggaagatag

DBGET integrated database retrieval system