KEGG   Rattus norvegicus (rat): 24230Help
Entry
24230             CDS       T01003                                 

Gene name
Tspo, Bzrp, MBR, PTBZR02, Ptbzr, RATPTBZR02
Definition
(RefSeq) translocator protein
  KO
K05770  translocator protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04979  Cholesterol metabolism
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24230 (Tspo)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    24230 (Tspo)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24230 (Tspo)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    24230 (Tspo)
Transporters [BR:rno02000]
 Other transporters
  Others
   24230 (Tspo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TspO_MBR
Motif
Other DBs
NCBI-GeneID: 24230
NCBI-ProteinID: NP_036647
RGD: 2228
Ensembl: ENSRNOG00000010549
UniProt: P16257
Position
7q34
AA seq 169 aa AA seqDB search
MSQSWVPAVGLTLVPSLGGFMGAYFVRGEGLRWYASLQKPSWHPPRWTLAPIWGTLYSAM
GYGSYIIWKELGGFTEEAMVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLMLVSGVAT
ATTLAWHRVSPPAARLLYPYLAWLAFATMLNYYVWRDNSGRRGGSRLTE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatcctgggtacccgccgtgggcctcactctggtgcccagcctggggggcttc
atgggagcctactttgtgcgtggtgagggcctccgctggtatgctagcttgcagaaaccc
tcctggcatccgcctcgctggacactcgctcccatctggggcacactgtattcggccatg
gggtatggctcctacataatctggaaagagctgggaggtttcacagaggaggctatggtt
cccttgggtctctacactggtcagctggctctgaactgggcatggccccccatcttcttt
ggtgcccggcagatgggctgggctttggtggacctcatgcttgtcagtggggtggcaacc
gccactaccctggcttggcaccgagtgagcccaccggctgcccgcttgctgtatccttac
ctggcctggctggcctttgccaccatgctcaactactatgtatggcgtgataactctggt
cggcgagggggctcccggctcacagagtga

DBGET integrated database retrieval system