KEGG   Rattus norvegicus (rat): 24235Help
Entry
24235             CDS       T01003                                 

Gene name
C4bpa, C4BP
Definition
(RefSeq) complement component 4 binding protein, alpha
  KO
K04002  complement component 4 binding protein alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05133  Pertussis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24235 (C4bpa)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    24235 (C4bpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi C4bp_oligo
Motif
Other DBs
NCBI-GeneID: 24235
NCBI-ProteinID: NP_036648
RGD: 2235
Ensembl: ENSRNOG00000004062
UniProt: Q5M891
Position
13q13
AA seq 601 aa AA seqDB search
MWTKQHQALRPTRAAHGKLHRNRDAVAWPLSTFCRASGPTLFQMSLTAALWVAVFGKCGP
PPDLPYALPASEMNQTDFESHTTLRYNCRPGYSRASSSQSLYCKPLGKWQINIACVKKSC
RNPGDLQNGKVEVKTDFLFGSQIEFSCSEGYILIGSSTSYCEIQGKGVSWSDPLPECVIA
KCGMPPDISNGKHNGREEEFFTYRSSVTYKCDPDFTLLGNASITCTVVNKTVGVWSPSPP
TCERIICPWPKVLHGTINSGFKHTYKYKDSVRFVCQKGFVLRGSGVIHCEADGSWSPVPV
CELNSCTDIPDIPNAALITSPRPRKEDVYPVGTVLRYICRPGYEPATRQPMTVICQKDLS
WSMLRGCKEICCPVPDPKSVRVIQHEKAHPDNDCTYFFGDEVSYTCQNDIMLTATCKSDG
TWHPRTPSCHQSCDFPPAIAHGRYTKSSSYYVRTQVTYECEEGYRLVGEATISCWYSQWT
PAAPQCKALCRKPEIGNGVLSTNKDQYVETENVTIQCDSGFVMLGSQSITCSENGTWYPK
VPRCEQEVPKDCEHVFAGKKLMQCLPNSNDVKMALEVYKLTLEIKQLQLQIDKAKHVDRE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgtggacaaagcagcaccaggccctgcgccccacaagagctgcccacgggaagcttcat
agaaacagagacgccgtggcctggcccttgtctacgttctgcagagcctccggtccaact
ttgttccaaatgagcctcactgctgctctttgggttgctgtattcggaaaatgtggccca
ccacctgatttaccctacgccctgccagcaagtgagatgaaccagacagactttgaaagt
cacactaccctgagatacaattgtcgccctggctatagtagagcgagctcaagccagagt
ctctactgtaaacctctggggaaatggcagattaatatcgcctgcgtcaaaaagtcatgc
aggaatccaggagacttacaaaatggaaaggtggaagttaagacagatttcttgtttgga
tcacagatagaattcagctgctcagagggatatatcttaattggctcatccactagttat
tgtgagatccaaggcaaaggagtttcctggagtgatcctctcccagaatgtgtaattgcc
aagtgtgggatgcctccagacatcagcaatgggaagcacaatggtagagaggaagaattc
ttcacatatcgttcctcagtcacctataagtgtgatcctgacttcacactccttggcaat
gcctccattacctgcactgtggtgaacaaaacagtaggtgtttggagcccaagccctcct
acctgtgaaagaatcatctgtccttggccaaaagttttgcatggaacaattaattctgga
ttcaagcatacctataaatacaaagactctgtgagatttgtctgccagaaagggtttgtc
ctcagaggcagcggtgtaatccattgtgaggctgatggcagctggagtcccgtaccagtg
tgtgagctcaatagttgcactgatattccagacattcctaatgctgccctgataaccagt
cccaggccaagaaaggaagatgtatatccagtgggtactgtgctccgttacatctgtcgt
cctggctatgaacctgctacgagacagcccatgactgtgatttgtcagaaagatctcagc
tggagcatgcttagggggtgtaaggagatatgctgtccagtaccagacccaaagagtgtt
agagtcattcaacatgaaaaggcacatcctgacaacgactgtacttacttctttggtgac
gaagtgtcatacacatgtcaaaatgatataatgcttacagctacttgcaagtcagatggc
acctggcatccccggacaccatcatgtcatcagagttgtgattttccgcctgccattgct
cacggacgttatacaaaatcttcttcatactacgtcagaactcaggttacatatgaatgt
gaagaaggatacagactggttggagaggcaaccatctcctgctggtattcacaatggaca
ccagcagctccacagtgtaaagctctatgtcggaaaccagagataggaaatggagtactg
tctactaataaagatcaatatgtcgaaactgaaaatgtcaccatccaatgtgactcgggc
tttgtcatgctaggttcccaaagcatcacttgttcggagaatggaacctggtacccaaag
gtgcccagatgtgagcaggaggtccctaaagactgtgagcacgtgtttgcaggcaagaag
ctcatgcaatgtctgccaaattcaaatgacgtgaaaatggccctggaggtctacaagctg
actctggagattaaacaattacagctccagatagacaaggcaaagcacgttgaccgggag
ttatga

DBGET integrated database retrieval system