KEGG   Rattus norvegicus (rat): 24245Help
Entry
24245             CDS       T01003                                 

Gene name
Camk2b, Ck2b
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04012  ErbB signaling pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04066  HIF-1 signaling pathway
rno04114  Oocyte meiosis
rno04217  Necroptosis
rno04261  Adrenergic signaling in cardiomyocytes
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04713  Circadian entrainment
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04740  Olfactory transduction
rno04750  Inflammatory mediator regulation of TRP channels
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04916  Melanogenesis
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04934  Cushing syndrome
rno04971  Gastric acid secretion
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05214  Glioma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    24245 (Camk2b)
   04310 Wnt signaling pathway
    24245 (Camk2b)
   04066 HIF-1 signaling pathway
    24245 (Camk2b)
   04020 Calcium signaling pathway
    24245 (Camk2b)
   04024 cAMP signaling pathway
    24245 (Camk2b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    24245 (Camk2b)
   04217 Necroptosis
    24245 (Camk2b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24245 (Camk2b)
   04922 Glucagon signaling pathway
    24245 (Camk2b)
   04912 GnRH signaling pathway
    24245 (Camk2b)
   04921 Oxytocin signaling pathway
    24245 (Camk2b)
   04916 Melanogenesis
    24245 (Camk2b)
   04925 Aldosterone synthesis and secretion
    24245 (Camk2b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    24245 (Camk2b)
  09154 Digestive system
   04971 Gastric acid secretion
    24245 (Camk2b)
  09156 Nervous system
   04725 Cholinergic synapse
    24245 (Camk2b)
   04728 Dopaminergic synapse
    24245 (Camk2b)
   04720 Long-term potentiation
    24245 (Camk2b)
   04722 Neurotrophin signaling pathway
    24245 (Camk2b)
  09157 Sensory system
   04740 Olfactory transduction
    24245 (Camk2b)
   04750 Inflammatory mediator regulation of TRP channels
    24245 (Camk2b)
  09158 Development
   04360 Axon guidance
    24245 (Camk2b)
  09159 Environmental adaptation
   04713 Circadian entrainment
    24245 (Camk2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24245 (Camk2b)
   05205 Proteoglycans in cancer
    24245 (Camk2b)
  09162 Cancer: specific types
   05214 Glioma
    24245 (Camk2b)
  09165 Substance dependence
   05031 Amphetamine addiction
    24245 (Camk2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24245 (Camk2b)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24245 (Camk2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24245 (Camk2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     24245 (Camk2b)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   24245 (Camk2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 SnoaL_2 APH Pkinase_fungal Kdo SnoaL_4
Motif
Other DBs
NCBI-GeneID: 24245
NCBI-ProteinID: NP_068507
RGD: 2262
Ensembl: ENSRNOG00000052080
UniProt: P08413 G3V9G3
Structure
PDB: 

Position
14q21
AA seq 542 aa AA seqDB search
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSSAITSPKGSLPPAALEPQTTVIHNPVDGIKESSDSTNTTIEDEDAKARKQEIIKTTEQ
LIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILN
PHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAP
LQ
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgtttcacggacgagtaccagctatacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagctaagatcattaacaccaagaagctgtcagctagagatcaccagaagctggagagg
gaggctcggatctgccgcctgctgaagcattccaacattgtacgcctccatgacagcatc
tctgaagagggcttccactacctggtcttcgacctggtcactggtggggagctctttgaa
gacattgtggcgagagagtactacagtgaggctgacgccagtcactgtatccagcagatc
ctggaggctgttctccattgtcaccaaatgggggtcgtccacagagacctcaagcctgaa
aacctgctcctggccagcaaatgcaaaggggccgcagtgaaactggcagacttcggcctg
gccatcgaggttcagggagaccagcaggcatggtttggatttgcgggaacaccaggctac
ctgtctcccgaagttcttcggaaggaggcctatggcaaaccagtggatatctgggcatgt
ggggtgatcctgtatatcctgctggtgggatacccacctttctgggatgaggaccagcac
aagctgtaccagcagatcaaggctggggcctatgacttcccatcccccgagtgggacacc
gttacccctgaagccaaaaacctcatcaaccagatgttgaccatcaaccccgccaagcgc
atcacggcccacgaggccctgaagcacccatgggtctgccaacgatccacggtggcctcc
atgatgcacagacaggagactgtggaatgtctgaagaagttcaatgcaaggaggaagctc
aagggagccatcctcaccactatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagacggagtcaagccccagacaaacagcaccaaa
aacagctcggccatcaccagccccaaaggatccctccctcctgccgccctggagcctcaa
accaccgttatccataacccagtggacggcattaaggaatcttccgacagcaccaacaca
accatagaggacgaagatgccaaagcccggaagcaggaaatcatcaagaccacagagcag
ctcatcgaggccgtcaacaacggcgactttgaggcctatgcgaaaatctgtgacccaggc
ctgacctcatttgagcctgaagctctgggcaacctggtcgaagggatggatttccacaga
ttctactttgagaacctgctggccaagaacagcaagccgatccacaccactatcctgaac
ccgcacgtgcacgtcatcggcgaggatgcagcctgcatcgcttacatccgcctcacacag
tacatcgacggccagggcagaccccgcaccagccagtccgaagagacccgtgtgtggcac
cgccgcgacggcaagtggcagaatgtccatttccactgctcgggcgctccagtggcccca
ctgcagtga

DBGET integrated database retrieval system