KEGG   Rattus norvegicus (rat): 24249Help
Entry
24249             CDS       T01003                                 

Gene name
S100g, Cabp, Calb3, Cbpi, Rncalbd9
Definition
(RefSeq) S100 calcium binding protein G
  KO
K14734  protein S100-G
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    24249 (S100g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: S_100 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 Sec5 EF-hand_10 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 24249
NCBI-ProteinID: NP_036653
RGD: 2253
Ensembl: ENSRNOG00000004222
UniProt: P02634
Position
Xq14
AA seq 79 aa AA seqDB search
MSAKKSPEEMKSIFQKYAAKEGDPNQLSKEELKLLIQSEFPSLLKASSTLDNLFKELDKN
GDGEVSYEEFEVFFKKLSQ
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctaagaaatctcccgaagaaatgaagagcatttttcaaaaatatgcagccaaa
gaaggcgatccaaaccagctgtccaaggaggagctgaagctgctgattcagtcagagttc
cccagcctcctgaaggcttcaagtactctagacaatctctttaaagagctggataagaac
ggtgatggagaagttagctatgaagaattcgaagttttcttcaaaaagttatcacaatga

DBGET integrated database retrieval system