KEGG   Rattus norvegicus (rat): 24250Help
Entry
24250             CDS       T01003                                 

Gene name
Cbs
Definition
(RefSeq) cystathionine beta synthase
  KO
K01697  cystathionine beta-synthase [EC:4.2.1.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00260  Glycine, serine and threonine metabolism
rno00270  Cysteine and methionine metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
Module
rno_M00035  Methionine degradation
rno_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    24250 (Cbs)
   00270 Cysteine and methionine metabolism
    24250 (Cbs)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.22  cystathionine beta-synthase
     24250 (Cbs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP CBS
Motif
Other DBs
NCBI-GeneID: 24250
NCBI-ProteinID: NP_036654
RGD: 2287
Ensembl: ENSRNOG00000029528
UniProt: P32232
Position
20p12
AA seq 547 aa AA seqDB search
MPSGTSQCEDGSAGCPQDLEVQPEKGQLEKGASGDKERVWISPDTPSRCTWQLGRPMADS
PHYHTVPTKSPKILPDILRKIGNTPMVRINRISKNAGLKCELLAKCEFFNAGGSVKDRIS
LRMIEDAERAGTLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRA
LGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQ
CDGKVDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEV
EGIGYDFIPTVLDRAVVDRWFKSNDDDSFAFARMLISQEGLLCGGSSGSAMAVAVKAAQE
LKEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWHLRVQELSLSAPLT
VLPTVTCEHTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLY
KQFKPIHLTDTLGMLSHILEMDHFALVVHEQIQYRNNGVSSKQLMVFGVVTAIDLLNFVA
AREQTRK
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgccttcagggacatcccagtgtgaagatggctctgcagggtgcccccaggacttggag
gtacagccagaaaaagggcaactggagaagggagcctcaggggacaaggaaagagtctgg
atctcgcctgataccccaagcagatgtacttggcagctgggcaggcccatggcggattcc
ccacattaccacacagtgccgacaaaatccccgaaaattttgccagatattctgaggaaa
attggcaacacccctatggtcagaatcaacaggatctccaagaatgcaggactcaagtgc
gagctgttggccaagtgtgagttcttcaacgccggtgggagtgtgaaggaccgcatcagc
ctccggatgattgaagacgctgagcgagccggaaccttgaagcccggagacacgatcatt
gagccaacttctggcaacacagggatcgggctggctctggcagctgctgtgaagggctat
cgctgcattatcgtgatgcctgagaagatgagtatggagaaggtggatgtgctgcgagct
ctgggagctgagattgtgaggacgcccaccaacgccagattcgattcccccgagtcccac
gtaggagtggcatggcgactgaagaacgaaatccccaattctcacattctggaccagtac
cgcaatgccagcaaccccttggcgcactacgatgacaccgcagaggagatcctgcagcag
tgcgacgggaaggtggacatgctggtggcttcagcaggcacgggtggcaccatcacgggt
atcgcgaggaagctgaaggagaagtgcccaggttgtaaaatcatcggtgtagatcccgag
gggtccatcctcgcggagcccgaggagctgaaccagacggagcaaacagcctatgaggtg
gaagggatcggctacgacttcatccccaccgtcctggacagggcggtggtggataggtgg
ttcaagagcaatgatgacgattccttcgccttcgcccgcatgctcatctcccaggaggga
ctgctgtgcggtgggagttcaggcagcgctatggccgtggctgtgaaggctgcccaggag
ctaaaggaaggacagcgctgtgtggtcatcctgcccgactctgtgcgcaactacatgtcc
aagttcttgagtgacaaatggatgctgcagaaaggcttcatgaaggaggagctctccgtg
aagagaccctggtggtggcatctgcgtgtccaagagctgagcctatcagcaccgctgacc
gtgttgcccactgtcacctgtgagcacaccatcgccatcctccgggagaagggttttgac
caggcacctgtggtcaacgagtctggggccatcctagggatggtgactctcgggaacatg
ttgtcctccctgcttgctgggaaggtgcggccatcagacgaagtctgcaaagtcctctac
aagcagttcaagccgatccacctgaccgacacactgggcatgctctcccacatcctggag
atggaccacttcgccctggtggtccatgagcagatccaataccgcaacaatggcgtgtcc
agcaagcagctgatggtgtttggtgttgtcaccgccattgacctgctaaacttcgtggca
gcccgtgagcagacccggaaatag

DBGET integrated database retrieval system