KEGG   Rattus norvegicus (rat): 24252
Entry
24252             CDS       T01003                                 

Gene name
Cebpa
Definition
(RefSeq) CCAAT/enhancer-binding protein alpha isoform a
  KO
K09055  CCAAT/enhancer binding protein (C/EBP), alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04932  Non-alcoholic fatty liver disease
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24252 (Cebpa)
   05202 Transcriptional misregulation in cancer
    24252 (Cebpa)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    24252 (Cebpa)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    24252 (Cebpa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24252 (Cebpa)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    24252 (Cebpa)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 Taxilin TolA_bind_tri bZIP_Maf Hema_stalk GAS Lipoprotein_20 DivIC Nup54
Other DBs
NCBI-GeneID: 24252
NCBI-ProteinID: NP_036656
RGD: 2326
Ensembl: ENSRNOG00000010918
UniProt: P05554
Structure
PDB: 
1NWQ

Position
1
AA seq 358 aa
MESADFYEAEPRPPMSSHLQSPPHAPSNAAFGFPRGAGPAPPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAAGPAGGGGDFDYPGAPAGPGGAVMSA
GAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQ
PPPPPPPPHPHASPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPAMGAA
GLPGPGGSLKGLAGPHPDLRTGGGGGGGAGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR
DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggagtcggccgacttctacgaggcggagccgcggcccccgatgagcagccacctccag
agccccccgcacgcgcccagcaacgccgcctttggctttccccggggcgcgggccccgcg
ccgcccccagccccacctgccgccccggagccgctgggcggcatctgcgagcacgagacg
tctatagacatcagcgcctacatcgacccggccgccttcaacgacgagttcctggccgac
ctcttccagcacagccggcagcaggagaaggccaaggcggcggcgggccccgcgggtggc
ggcggtgactttgactacccgggcgccccggcgggccccggcggtgcggtcatgtccgcg
ggggcgcacggaccccctcccggctacggctgtgcggcggccggctacctggacggcagg
ctggagcccctgtacgagcgcgtcggggcgcccgcgctgcggccgctggtgatcaagcag
gagccccgcgaggaggacgaggcgaagcagctggcgctggccggcctcttcccctatcag
cccccgccgccgccgccgccaccgcacccgcacgcgtctcccgcgcacttggccgcccct
cacttgcagttccagatcgcacactgcggccagaccaccatgcacctgcagcctggccac
cctacgccgccgccgacgcccgtgcccagccctcatcccgcgcctgcaatgggtgctgcg
ggcctgccgggccccgggggctcgctcaagggcttggctggtccgcaccccgacctccgc
accggcggcggcggcggcggcggggccggcgcgggcaaggccaagaagtcggtggataag
aacagcaacgagtaccgggtacggcgggaacgcaacaacatcgcggtgcgcaagagccga
gataaagccaaacagcgcaacgtggagacgcagcagaaggtgttggagttgaccagtgac
aatgaccgcctgcgcaagcgggtggaacagctgagccgtgaactggacacgctgcggggt
atcttccgccagctgcctgagagctccttggtcaaggccatgggcaactgcgcgtga

DBGET integrated database retrieval system