KEGG   Rattus norvegicus (rat): 24253
Entry
24253             CDS       T01003                                 

Gene name
Cebpb
Definition
(RefSeq) CCAAT/enhancer-binding protein beta isoform LAP1
  KO
K10048  CCAAT/enhancer binding protein (C/EBP), beta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05152  Tuberculosis
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    24253 (Cebpb)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    24253 (Cebpb)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    24253 (Cebpb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    24253 (Cebpb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24253 (Cebpb)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   C/EBP-like factors
    24253 (Cebpb)
SSDB
Motif
Pfam: bZIP_2 bZIP_1 CCD48 Taxilin SBDS_C DUF3450 Nup54 bZIP_Maf Uds1 UPF0242 DUF2730
Other DBs
NCBI-GeneID: 24253
NCBI-ProteinID: NP_077039
RGD: 2327
Ensembl: ENSRNOG00000057347
UniProt: P21272
Position
3
AA seq 297 aa
MHRLLAWDAACLPPPPAAFRPMEVANFYYEPDCLAYGAKAARAAPRAPAAEPAIGEHERA
IDFSPYLEPLAPAAADFAAPAPAHHDFLSDLFADDYGAKPSKKPSDYGYVSLGRAGAKAA
PPACFPPPPPAALKAEPGFEPADCKRADDAPAMAAGFPFALRAYLGYQATPSGSSGSLST
SSSSSPPGTPSPADAKAAPAACFAGPPAAPAKAKAKKAVDKLSDEYKMRRERNNIAVRKS
RDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASAGHC
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcaccgcctgctggcctgggacgcagcatgcctcccgccgccgcccgccgcctttaga
cccatggaagtggccaacttctactacgagcccgactgcctggcctacggggccaaggcg
gcccgcgccgcgccgcgcgcccccgccgccgagccggccatcggcgagcacgagcgcgcc
atcgacttcagcccctacctggagccgctcgcgcccgccgccgcggacttcgccgcgccc
gcgcccgcgcaccacgacttcctttccgacctcttcgccgacgactacggcgccaagccg
agcaagaagccgtccgactacggttacgtgagcctcggccgcgcgggcgccaaggccgca
ccgcccgcctgcttcccgccgccgcctcccgccgcactcaaggccgagccgggcttcgaa
cccgcggactgcaagcgcgcggacgacgcgcccgccatggcggccggcttcccgttcgcc
ctgcgcgcctacctgggctaccaggcgacgccgagcggcagcagcggcagcctgtccacg
tcgtcgtcgtccagcccgcccgggacgccgagccccgccgacgccaaggccgcgcccgcc
gcctgcttcgcggggccgccggccgcgcccgccaaggccaaggccaagaaggcggtggac
aagctgagcgacgagtacaagatgcggcgcgagcgcaacaacatcgcggtgcgcaagagc
cgcgacaaggccaagatgcgcaacctggagacgcagcacaaggtgctggagctgacggcg
gagaacgagcggctgcagaagaaggtggagcagctgtcgcgagagctcagcacgctgcgg
aacttgttcaagcagctgcccgagccgctgctggcctcggcgggtcactgctag

DBGET integrated database retrieval system