KEGG   Rattus norvegicus (rat): 24258
Entry
24258             CDS       T01003                                 

Gene name
Chga
Definition
(RefSeq) chromogranin A
  KO
K19990  chromogranin-A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    24258 (Chga)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Others
   Others
    24258 (Chga)
SSDB
Motif
Pfam: Granin PP1_bind
Other DBs
NCBI-GeneID: 24258
NCBI-ProteinID: NP_067687
RGD: 2338
Ensembl: ENSRNOG00000052549
UniProt: Q5PPG5
Position
6q32
AA seq 465 aa
MRSSAALALLLCAGQVFALPVNSPMTKGDTKVMKCVLEVISDSLSKPSPMPVSPECLETL
QGDERVLSILRHQNLLKELQDLALQGAKERAQQQQQQQQQQQQQQQQQQQHSSFEDELSE
VFENQSPAAKHGDAASEAPSKDTVEKREDSDKGQQDAFEGTTEGPRPQAFPEPKQESSMM
GNSQSPGEDTANNTQSPTSLPSQEHGIPQTTEGSERGPSAQQQARKAKQEEKEEEEEEKE
EEEEEKEEKAIAREKAGPKEVPTAASSSHFYSGYKKIQKDDDGQSESQAVNGKTGASEAV
PSEGKGELEHSQQEEDGEEAMAGPPQGLFPGGKGQELERKQQEEEEEEERLSREWEDKRW
SRMDQLAKELTAEKRLEGEDDPDRSMKLSFRARAYGFRDPGPQLRRGWRPSSREDSVEAR
GDFEEKKEEEGSANRRAEDQELESLSAIEAELEKVAHQLQALRRG
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgcgctcctccgcggctttggcgcttctgctgtgcgccgggcaagtctttgcccttcct
gtgaacagccctatgacaaaaggggacactaaggtgatgaagtgtgtcctggaggtcatc
tccgactcgctgtccaaacccagccccatgcctgtcagccctgagtgtctggagaccctc
caaggagatgagagggtcctctccatccttcgacaccagaatttgctgaaggaacttcaa
gacctggcgcttcaaggtgccaaggagcgggcccagcagcagcagcagcagcagcagcag
cagcagcagcagcagcagcaacaacaacaacacagcagctttgaggatgaactctcggaa
gtatttgagaaccagagccctgcagccaagcatggagacgcagcatcagaagccccctcc
aaggacactgtagagaagagagaggattctgacaaggggcaacaggatgcctttgaggga
accacagaaggacccagacctcaggcctttccagagcccaagcaggagtcctctatgatg
ggaaacagtcaatctccaggggaggacacagccaacaatacccaatcaccaaccagcctc
cccagccaggagcatgggattccacagaccacagaaggcagtgagagaggtcccagtgcc
cagcagcaagccagaaaagccaagcaagaggagaaagaggaagaggaggaggagaaagag
gaagaggaggaggagaaagaggagaaggcgatcgccagagagaaggctgggcctaaagaa
gtccccacggcagcatccagttctcacttctattcaggctacaagaagatccagaaagat
gatgatggtcagtcggagtctcaggcagtgaatggaaagacaggggcttctgaagctgtg
ccatctgaagggaagggggagctggagcactctcagcaggaggaagatggggaagaggcc
atggcagggcccccccaaggtctcttcccaggtgggaagggccaggagctggaacgtaag
cagcaggaggaggaagaggaagaggagcgtctgtccagagaatgggaggacaagcgatgg
agcaggatggaccagctggccaaggagctgacagcagagaagcggctggagggggaagat
gaccctgaccggtccatgaagctctccttccgggcccgggcctatggcttcagggaccct
gggcctcagctacgccggggctggaggccatcttccagagaagacagtgtggaggcccga
ggcgactttgaggaaaagaaggaagaggagggcagcgccaaccgcagagcagaggaccag
gagctagagagcctgtcagccatcgaggcagagctggagaaggtggcccaccagctgcag
gctttgcgacggggatga

DBGET integrated database retrieval system