KEGG   Rattus norvegicus (rat): 24260Help
Entry
24260             CDS       T01003                                 

Gene name
Chrm3
Definition
(RefSeq) cholinergic receptor, muscarinic 3
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04725  Cholinergic synapse
rno04742  Taste transduction
rno04810  Regulation of actin cytoskeleton
rno04911  Insulin secretion
rno04970  Salivary secretion
rno04971  Gastric acid secretion
rno04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24260 (Chrm3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24260 (Chrm3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24260 (Chrm3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    24260 (Chrm3)
  09154 Digestive system
   04970 Salivary secretion
    24260 (Chrm3)
   04971 Gastric acid secretion
    24260 (Chrm3)
   04972 Pancreatic secretion
    24260 (Chrm3)
  09156 Nervous system
   04725 Cholinergic synapse
    24260 (Chrm3)
  09157 Sensory system
   04742 Taste transduction
    24260 (Chrm3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24260 (Chrm3)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    24260 (Chrm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 24260
NCBI-ProteinID: NP_036659
RGD: 2343
Ensembl: ENSRNOG00000049410
UniProt: P08483
Position
17q12.1
AA seq 589 aa AA seqDB search
MTLHSNSTTSPLFPNISSSWVHSPSEAGLPLGTVTQLGSYNISQETGNFSSNDTSSDPLG
GHTIWQVVFIAFLTGFLALVTIIGNILVIVAFKVNKQLKTVNNYFLLSLACADLIIGVIS
MNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKRT
TKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPPGECFIQFLSEPTITFGTAIAAFY
MPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQGVK
RSSRRKYGRCHFWFTTKSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSET
RAIYSIVLKLPGHSSILNSTKLPSSDNLQVSNEDLGTVDVERNAHKLQAQKSMGDGDNCQ
KDFTKLPIQLESAVDTGKTSDTNSSADKTTATLPLSFKEATLAKRFALKTRSQITKRKRM
SLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVNP
VCYALCNKTFRTTFKTLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcacagtaacagtacaacctcgcctttgtttcccaacatcagctcttcctgg
gtgcacagtccctcggaggcagggctgcccttggggacagtcactcagttgggcagctac
aacatttcacaagaaactgggaatttctcctcaaacgacacctccagcgaccctctcggg
ggtcacaccatctggcaagtggtcttcattgccttcttaaccggcttcctggcattggtg
accatcattggcaacatccttgtcattgtggccttcaaggtcaacaaacagctgaagaca
gtcaacaactacttcctcttaagcctggcctgtgcagacctgatcatcggggtcatttcc
atgaacctgttcactacctacatcattatgaaccgttgggcactggggaacttagcctgc
gacctctggctttccattgactatgtggccagcaatgcctctgtcatgaatctgctggtc
atcagctttgacaggtacttttccatcactagaccactcacctaccgagccaaaagaaca
acaaaacgagctggtgtgatgattggtctggcttgggtcatctcctttgtcctatgggct
cctgccatcttgttctggcaatactttgtagggaagagaactgtgcccccaggagaatgt
ttcattcagtttctgagtgagcccaccatcaccttcggcacggcgatcgctgccttttac
atgcctgtcaccatcatgactattttatactggaggatctataaggaaactgagaagcgt
accaaagagctggctggcctacaggcctctgggacagaagcggaggcagaaaactttgtc
caccccacaggcagttctcgaagctgtagcagctatgaactgcaacagcaaggcgtgaaa
cgatcatccaggaggaagtacggtcgctgtcacttctggttcaccaccaagagctggaag
cccagtgccgagcagatggaccaagaccacagcagcagcgacagttggaacaacaacgat
gctgctgcctccctggaaaactctgcttcctccgatgaagaggacattggctcagagacc
agggccatctattccattgtcctcaagcttccaggccatagctccatcctcaactctacc
aagctaccgtcctcagataacctgcaggtgtccaacgaggacctggggactgtggatgtg
gagagaaatgctcacaagcttcaggcccagaagagcatgggtgatggtgacaactgtcag
aaggatttcaccaagcttcccatccagttagagtctgccgtggacacaggcaagacctct
gacaccaactcctcggcagacaagaccacggctactctacctctgtccttcaaggaggcc
acgctggctaagaggtttgctctcaagaccagaagtcagatcaccaagcggaagaggatg
tcgctcatcaaggagaagaaggccgcccagacgctcagtgccatcttgctagccttcatc
atcacgtggaccccctacaacatcatggtcctggtgaacaccttctgtgacagctgcata
cccaaaacctattggaatctgggctactggctgtgctatatcaacagcaccgtgaaccct
gtgtgctatgccctgtgcaacaaaacattcagaaccaccttcaagacgctcctcttgtgc
cagtgtgacaaaaggaagaggcgcaaacagcagtaccagcagagacagtcggtcattttt
cacaagcgagtgccggaacaggccttgtag

DBGET integrated database retrieval system