KEGG   Rattus norvegicus (rat): 24261
Entry
24261             CDS       T01003                                 

Symbol
Chrnb1
Name
(RefSeq) acetylcholine receptor subunit beta precursor
  KO
K04812  nicotinic acetylcholine receptor beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24261 (Chrnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    24261 (Chrnb1)
Ion channels [BR:rno04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   24261 (Chrnb1)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 24261
NCBI-ProteinID: NP_036660
RGD: 2349
Ensembl: ENSRNOG00000014698
UniProt: P25109
Position
10
AA seq 501 aa
MALGALLLILGILGTPLAPGARGSEAEGQLLKKLFSDYDSSVRPAQEVGDRVGVSIGLTL
AQLISLNEKDEEMSTKVYLDLEWTDYRLSWDPAEHDGIESLRVTAESVWLPDVVLLNNND
GNFDVALDINVVVSFEGSVRWQPPGLYRSSCSIQVTYFPFDWQNCTMVFSSYSYDSSEVS
LKTGPDPDGQERQEIYIHEGTFIENGQWEIIHKPSRLIHLPGDRRGGKEGHREEVIFYLI
IRRKPLFYLVNVIAPCILITLLAIFVFYLPPDAGEKMGLSIFALLTLTVFLLLLADKVPE
TSLAVPIIIKYLMFTMILVTFSVILSVVVLNLHHRSPHTHQMPFWVRQIFIHKLPPYLGL
KRPKPERDQLPEPHHSFSPRSGWGRGTDEYFIRKPPCDFLFPKLNRFQPESPAPDLRRFI
DGPPRAVGLPQELREVISSISYMARQLQEQEDHDALKEDWQFVAMVVDRLFLWTFIVFTS
VGTLVIFLDATYHLPPPEPFP
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggccttaggggcgctgcttctgattctggggatactcgggacgcccctcgccccagga
gcccgcgggtcggaagccgaaggccaactgcttaagaaacttttctcggattatgatagc
tcagtaaggccggcgcaggaggtgggagaccgcgtcggggtcagcatcggcctcaccctg
gcgcaactcatcagcctgaacgagaaggatgaagaaatgagcacaaaggtgtacttagac
ctggagtggaccgactacaggttaagctgggaccccgcagaacacgatggcatcgagtct
ctccgtgtcactgctgaatctgtttggctcccggacgtggtgctgctgaacaacaatgat
ggaaactttgacgttgccctggacattaatgtcgtggtgtcctttgagggctctgtgcgc
tggcaaccccctggcctgtatcgcagcagctgcagcatccaggtcacctacttccccttt
gactggcagaattgcaccatggtgtttagttcctacagctatgacagctctgaggtcagc
ctgaagacaggcccagatcctgatggacaggagaggcaggaaatctacatccatgaaggg
accttcatcgagaatggtcaatgggagattatccacaaaccctctaggttaatccacctt
ccaggggatcgaagaggagggaaggaaggacatcgtgaggaagttatcttctatctcatt
attcggaggaagcctctcttctacctggtcaatgtcattgccccgtgcatcctcatcacc
ctcctggccatctttgttttctaccttccaccagatgcaggagagaagatggggctctcc
atctttgccctgctgaccctcactgtgttcttgctgctgctggccgacaaagtgcctgag
acctccctggcggtccccatcatcatcaagtatctcatgtttaccatgatccttgtcacc
ttctcagttatccttagcgttgtggtcctcaacttgcaccatcgctcaccccacacccac
caaatgcccttttgggtccgccagatcttcattcacaagctccctccatacctgggtctg
aagaggcccaaacccgagagagaccaactacccgaaccacatcactccttctccccaagg
agtggctggggccgaggaactgatgaatatttcatacggaagcctccatgtgattttctt
ttccctaaacttaacaggtttcagcctgaatcacctgctccggacctgagacgatttatc
gatggtccaccccgggctgtaggtctgcctcaggagctacgcgaggtcatttcttccatc
agctacatggcccgacaacttcaggaacaggaggaccacgatgcactgaaggaggactgg
cagtttgtcgccatggttgtggaccgtctttttctgtggacattcatcgttttcacaagc
gtcgggacgctagtcattttcctagatgccacgtaccatttgccccctcctgaacctttt
ccttga

DBGET integrated database retrieval system