KEGG   Rattus norvegicus (rat): 24265
Entry
24265             CDS       T01003                                 

Gene name
Ckm, Ckmm
Definition
(RefSeq) creatine kinase, M-type
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00330  Arginine and proline metabolism
rno01100  Metabolic pathways
Module
rno_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    24265 (Ckm)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24265 (Ckm)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     24265 (Ckm)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   24265 (Ckm)
SSDB
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Other DBs
NCBI-GeneID: 24265
NCBI-ProteinID: NP_036662
RGD: 2358
Ensembl: ENSRNOG00000016837
UniProt: P00564 A0A0G2JSP8
Position
1q21
AA seq 381 aa
MPFGNTHNKFKLNYKSQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENLKGGDD
LDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT
EQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLA
NLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGQSIDDMIPAQK
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgccgttcggcaacacccacaacaagttcaagctgaactacaagtcgcaggaggagtac
ccagacctcagcaaacacaacaaccacatggccaaggtgctgactcctgacctctacaat
aagcttcgagacaaggagaccccatccggcttcactctggacgatgtcatccagactggg
gtggacaacccgggtcaccctttcatcatgacggtcggctgtgtggccggcgatgaggag
tcctacactgttttcaaggacctgtttgaccccatcatccaggaccgccatggtggcttc
aaacccacagacaagcataagaccgacctcaaccacgagaacctcaagggtggagacgat
ctggaccccaactatgtgctgagcagccgcgtgcgcactggccgcagcatcaagggctac
actctgcccccgcactgctcccgcggagagcgccgtgctgtagagaagctgtccgtggaa
gctctcaacagcctgacaggcgagttcaagggcaaatactaccctctgaagagcatgaca
gagcaggagcagcagcagctcattgatgaccacttcctgtttgacaagcccgtgtcacct
ctgctgctggcctcaggcatggcccgagactggcccgacgcccgtggcatctggcacaac
gacaacaaaagcttcctggtgtgggtgaatgaggaggaccaccttcgcgtgatctccatg
gagaaaggaggcaatatgaaggaagttttccgccgcttctgcgtgggcctgcagaagatt
gaggagatcttcaagaaggctggtcaccccttcatgtggaacgagcacctgggctacgtg
ctcacctgcccctccaacctgggcaccgggctgcgcggaggcgtgcacgtgaagctggcg
aacctgagcaagcaccccaagtttgaggagattctcacccgccttcgtctgcagaagcgc
ggcacaggtggcgtggacaccgctgcggtgggcgccgtgttcgacatctccaacgccgat
cggctgggctcttccgaggtcgaacaggtgcagctggtggtggatggcgtaaagcttatg
gtggagatggagaagaagctggaaaaaggccagtccatcgacgacatgatccctgcgcag
aagtag

DBGET integrated database retrieval system