KEGG   Rattus norvegicus (rat): 24267
Entry
24267             CDS       T01003                                 

Gene name
Comt
Definition
(RefSeq) catechol O-methyltransferase
  KO
K00545  catechol O-methyltransferase [EC:2.1.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00350  Tyrosine metabolism
rno01100  Metabolic pathways
rno04728  Dopaminergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    24267 (Comt)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    24267 (Comt)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    24267 (Comt)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24267 (Comt)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     24267 (Comt)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   24267 (Comt)
SSDB
Motif
Pfam: Methyltransf_3 Methyltransf_24 CmcI PCMT
Other DBs
NCBI-GeneID: 24267
NCBI-ProteinID: NP_036663
RGD: 2379
Ensembl: ENSRNOG00000001889
UniProt: P22734 F2W8B0
Structure
PDB: 

Position
11
AA seq 264 aa
MPLAAVSLGLLLLALLLLLRHLGWGLVTIFWFEYVLQPVHNLIMGDTKEQRILRYVQQNA
KPGDPQSVLEAIDTYCTQKEWAMNVGDAKGQIMDAVIREYSPSLVLELGAYCGYSAVRMA
RLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKYDVDTLDM
VFLDHWKDRYLPDTLLLEKCGLLRKGTVLLADNVIVPGTPDFLAYVRGSSSFECTHYSSY
LEYMKVVDGLEKAIYQGPSSPDKS
NT seq 795 nt   +upstreamnt  +downstreamnt
atgccgttggctgcagtctcattgggtctcctgttgttggccctcctcctgctcttgcga
cacctgggctggggcttggtgactattttctggtttgagtacgtgctgcagccagtccac
aacctgatcatgggtgacacaaaggagcagcgcatcctgcgctacgtgcagcagaatgca
aagcctggagaccctcagagcgtcctggaggccatcgacacctactgcacacagaaggaa
tgggccatgaatgtgggtgacgcgaaaggccaaatcatggatgcagtgattcgggagtac
agcccctccctggtgctggagctgggagcttactgtggctactcagcagtgcgaatggct
cgcctgctgcagcctggagccaggcttctcaccatggagatgaaccctgactacgctgcc
atcacccagcaaatgctgaactttgcaggcctacaggacaaagtcaccatcctcaatggg
gcatcccaggatcttatcccccagctgaagaagaagtacgacgtggacacactagacatg
gtctttcttgaccactggaaagaccgctaccttccagacacacttctcctggagaaatgt
ggcctgctgcgcaaggggacagtgctcctagctgacaacgtcatcgtcccgggaacccct
gacttcctggcgtatgtgagagggagcagcagcttcgagtgcacacactacagctcatac
ctggagtacatgaaagttgtagacggcttggagaaggcaatctaccagggtccaagtagc
cctgacaagtcttga

DBGET integrated database retrieval system