KEGG   Rattus norvegicus (rat): 24268Help
Entry
24268             CDS       T01003                                 

Gene name
Cp, CERP
Definition
(RefSeq) ceruloplasmin
  KO
K13624  ceruloplasmin [EC:1.16.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00860  Porphyrin and chlorophyll metabolism
rno04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    24268 (Cp)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    24268 (Cp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24268 (Cp)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.1  ferroxidase
     24268 (Cp)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   24268 (Cp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu-oxidase_2 Cu-oxidase_3
Motif
Other DBs
NCBI-GeneID: 24268
NCBI-ProteinID: NP_001257890
RGD: 2387
Ensembl: ENSRNOG00000011913
UniProt: A0A0G2K9I6
Structure
PDB: 

Position
2q24
AA seq 1084 aa AA seqDB search
MKFLLLSALLFLHSSLAWTREKHYYIGITEAVWDYASGSEEKELISVDTEQSNFYLRNGP
DRIGRKYKKALYSEYTDGTFTKTIDKPAWLGLLGPVIKAEVGDKVSVHVKNFASRPYTFH
AHGVTYTKANEGAIYPDNTTDFQRADDKLFPGQQYLYVLRANEPSPGEGDSNCVTRIYHS
HVDAPKDIASGLIGPLILCKKGSLHKEKEENIDQEFVLMFSVVDENLSWYLEDNIKTFCS
EPEKVDKDNEDFQESNRMYSINGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHSALFHG
QALTSKNYHTDIINLFPATLIDVSMVAQNPGVWMLSCQNLNHLKAGLQAFFQVRDCNKPS
PDDDIQDRHVRHYYIAAEETIWDYAPSGTDTFTGENLTSLGSDSRVFFEQGATRIGGSYK
KLVYREYTDDSFTNRKQRGPDEEHLGILGPVIWAEVGDIIRVTFHNKGQFPLSIQPMGVR
FTKENEGTYYGPDGRSSKQASHVAPKETFTYEWTVPKEMGPTYADPVCLSKMYYSGVDLT
KDIFTGLIGPMKICKKGSLLADGRQKDVDKEFYLFATVFDENESLLLDDNIRMFTTAPEN
VDKEDEDFQESNKMHSMNGFMYGNLPGLNMCLGESIVWYLFSAGNEADVHGIYFSGNTYL
SKGERRDTANLFPHKSLTLLMTPDTEGSFDVECLTTDHYTGGMKQKYTVNQCKGQFEDVT
LYQGERTYYIAAVEVEWDYSPSRDWEMELHHLQEQNVSNAFLDKEEFFIGSKYKKVVYRE
FTDSTFREQVKRRAEEEHLGILGPLIHADVGDKVKVVFKNMASRPYSIHAHGVKTKSSTV
APTLPGEVRTYIWQIPERSGAGTEDSPCIPWAYYSTVDRVKDLYSGLIGPLIVCRKSYVK
VFNPKKKMEFSLLFLVFDENESWYLDDNINTYSDHPEKVNKDNEEFIESNKMHAINGKMF
GNLQGLTMHVGDEVNWYVMAMGNEIDLHTVHFHGHSFQYKHRGIHSSDVFDLFPGTYQTL
EMFPQTPGTWLLHCHVTDHIHAGMVTTYTVLPNQASSQSYRMTWNILYTLLISMTTLFQI
STKE
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttgctgcttagtgcacttttatttttgcatagttccttagcttggacaaga
gaaaagcattattacatcggaattactgaagcagtttgggactatgcttctggcagtgaa
gaaaaggaacttatttcagttgacacggaacagtccaatttctatcttcgaaatggtcca
gatcgtattggaagaaagtataagaaggccctttattctgagtacacagatggcaccttt
acgaagactatagacaaaccagcctggctagggcttttaggccctgtcatcaaagctgaa
gttggagacaaagtttctgttcacgtaaagaactttgcctctaggccctacacttttcat
gctcatggggtaacttacaccaaggcgaacgagggggccatctaccctgacaacaccact
gattttcaaagagccgatgacaaactgtttcctggacagcagtatttgtacgtgctgcgt
gccaatgagccaagtcctggcgagggagacagcaattgtgtgaccaggatttaccactct
catgtggatgctccaaaagatattgcatcaggactcataggaccgttgatactctgtaaa
aaaggttctctgcataaggaaaaagaggaaaatattgaccaagaattcgtactgatgttc
tctgtggtggatgaaaatctcagctggtatctagaagataacatcaaaaccttctgctcg
gaaccagagaaagtcgataaagacaatgaagacttccaggaaagcaacaggatgtactct
ataaatggatatacatttggaagcctcccagggctctcgatgtgtgcagaagacagagtg
aagtggtacctttttgggatggggaatgaagttgacgtgcattcagcgctctttcatggt
caagccctgaccagcaagaactatcatactgatataatcaacctgttccctgccactcta
attgatgtttctatggtggcccagaatcctggagtctggatgctcagttgccagaacctg
aaccatctgaaagctggtttgcaggcctttttccaggttcgtgactgcaacaagccctca
ccggacgacgatatccaagacagacatgtgagacattattacatcgctgccgaggagacc
atttgggactatgctccgtctgggacagacaccttcactggagagaacttaaccagtctg
ggaagtgattcaagggtattttttgagcaaggtgctacaagaattggtggctcttataaa
aaattggtttatcgtgagtacacagatgattccttcacaaaccggaagcaaagaggccct
gatgaggaacatcttggaatccttggtcctgtcatttgggcagaagtaggagacatcatt
agagtcacctttcataacaaaggacaatttcctctcagcattcagccaatgggggtaaga
ttcaccaaggaaaatgagggaacatactatggcccagatggccgttcctcaaagcaagcc
tcccatgtggctcccaaagaaacctttacgtatgaatggactgtccccaaagaaatggga
cccacttatgcagatcctgtgtgcctatctaagatgtattattctggagttgacctcacc
aaagatatatttactgggcttattgggccaatgaaaatatgcaagaaaggcagcttactt
gcagatgggagacagaaagatgtagacaaggagttctacttgtttgcaacagtgtttgat
gagaatgagagtttactcttggatgataatatcagaatgttcacaactgcacctgagaat
gtggacaaggaagatgaagactttcaggagtccaacaagatgcactccatgaatggattc
atgtatggcaatctgcctggcctcaatatgtgtctaggagaatccatcgtgtggtatttg
ttcagcgctggaaatgaggcagacgtgcatgggatatacttttcaggaaatacctatctg
tccaaaggagaaagaagagacactgcaaatctatttcctcataaaagtctcacccttctc
atgacacctgacacagaagggtcttttgatgttgagtgtcttacaacagatcactacacc
ggtggcatgaagcaaaagtacactgtgaaccagtgcaaggggcagtttgaagatgtcact
ctctaccagggagaaaggacctactatattgcagcagtggaggtggaatgggattattca
ccaagcagggactgggaaatggagctgcaccatttgcaagagcaaaatgtttcaaatgca
tttttggataaggaagagtttttcataggctcaaagtacaagaaggttgtgtatcgagag
tttactgacagcacattcagagaacaggtgaagagaagagctgaagaggagcacttgggc
atcctcggtccactgattcatgcagatgttggagacaaagttaaagttgtctttaaaaat
atggcaagcaggccatattcaatacatgcccacggagtgaaaacaaagagttctacagtt
gctccaacgttaccaggtgaagttcgcacttatatatggcaaattccagaaagatcaggt
gctggaacggaggattcaccttgtatcccatgggcttattactcaaccgtggatcgagtt
aaggatctctatagtgggctaataggcccattgattgtttgtcggaaatcttatgtgaaa
gtattcaatcctaaaaagaaaatggagttttcccttttgtttctagtatttgatgagaat
gaatcttggtacttagatgataacatcaatacatactctgatcaccctgagaaagtaaac
aaagacaacgaggaattcatagaaagcaataaaatgcatgctatcaatgggaaaatgttc
ggaaacctacaaggtctcacgatgcacgtgggagacgaggtcaactggtatgtgatggct
atgggcaatgaaatagacctgcacactgtacacttccacggccacagcttccaatacaag
cacaggggaattcatagttctgatgtctttgacctttttcctggaacataccaaacccta
gagatgtttccccaaacgcctggaacctggttactccactgccatgtgactgaccatatt
catgcggggatggtaactacctacactgttttaccaaatcaagcatcgtctcagagctac
aggatgacctggaacatactctatacactgttaatcagcatgactactttattccaaata
tctaccaaggagtag

DBGET integrated database retrieval system