KEGG   Rattus norvegicus (rat): 24282
Entry
24282             CDS       T01003                                 

Gene name
Prl3d4, Csh1l1, Csh1v, Pl-Iv
Definition
(RefSeq) prolactin family 3, subfamily d, member 4
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 24282
NCBI-ProteinID: NP_150236
RGD: 2428
Ensembl: ENSRNOG00000055384
UniProt: P34207
Position
17p12
AA seq 223 aa
MQLTLTLSGSSMQLLLLVSNLLLWENMASKPTVLVSTEDLYHRLVEQSHNTFIKAADVYR
EFDINFAKRSWMKDRILPLCHTASIHVPENREEVHEIKTEDLLRSIINISVSWKEPLKHF
VSAVTDLPGASASMRKKAVDMKDKNLIILEGLQKIFNRTQTKVEENENFDYPAWSGLKDL
QSSDEDTHLFAIYNLCRCFKSDIHKIDTYLKVLRCRVVFKNEC
NT seq 672 nt   +upstreamnt  +downstreamnt
atgcagctaactttgactctttcaggctccagtatgcaactgttgctgctggtgtcaaac
ctgctcttgtgggaaaacatggcctccaaaccaactgtgcttgtgtccactgaagacctg
tatcatcgtttggttgaacagtctcataatacatttatcaaggctgcagatgtataccgt
gaatttgatataaattttgccaagagaagttggatgaaagacaggatacttcccctgtgt
cacactgcttccatccacgttccagagaatcgagaggaagttcatgaaattaaaactgaa
gaccttctgagatcaatcatcaatatttcagtttcctggaaagaacctctcaaacacttt
gtgtctgcagtgactgatcttccgggagcttctgctagtatgaggaaaaaagctgttgat
atgaaggacaaaaatcttataattctggagggacttcagaaaatattcaacaggactcag
actaaggttgaagaaaatgaaaattttgactaccctgcctggtctggactcaaagacttg
cagtcatctgatgaagacactcatctttttgccatttataatctgtgccgctgctttaaa
agtgacatccataagattgacacttatctcaaagtcttgaggtgccgagttgtctttaag
aatgagtgttga

DBGET integrated database retrieval system