KEGG   Rattus norvegicus (rat): 24303Help
Entry
24303             CDS       T01003                                 

Gene name
Cyp2d3, Cyp2d13, Cyp2d6
Definition
(RefSeq) cytochrome P450, family 2, subfamily d, polypeptide 3
  KO
K07414  cytochrome P450 family 2 subfamily D [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    24303 (Cyp2d3)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    24303 (Cyp2d3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     24303 (Cyp2d3)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   24303 (Cyp2d3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 24303
NCBI-ProteinID: NP_775116
RGD: 2472
Ensembl: ENSRNOG00000029179
UniProt: P12938
Position
7q34
AA seq 500 aa AA seqDB search
MELLAGTGLWPMAIFTVIFILLVDLMHRRQRWTSRYPPGPVPWPVLGNLLQVDLCNMPYS
MYKLQNRYGDVFSLQMGWKPVVVINGLKAVQELLVTCGEDTADRPEMPIFQHIGYGHKAK
GVVLAPYGPEWREQRRFSVSTLRNFGVGKKSLEQWVTDEASHLCDALTAEAGRPLDPYTL
LNKAVCNVIASLIYARRFDYGDPDFIKVLKILKESMGEQTGLFPEVLNMFPVLLRIPGLA
DKVFPGQKTFLTMVDNLVTEHKKTWDPDQPPRDLTDAFLAEIEKAKGNPESSFNDANLRL
VVNDLFGAGMVTTSITLTWALLLMILHPDVQCRVQQEIDEVIGQVRHPEMADQAHMPFTN
AVIHEVQRFADIVPMNLPHKTSRDIEVQGFLIPKGTTLIPNLSSVLKDETVWEKPLRFHP
EHFLDAQGNFVKHEAFMPFSAGRRACLGEPLARMELFLFFTCLLQRFSFSVPTGQPRPSD
YGVFAFLLSPSPYQLCAFKR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctggctgggactggcctgtggcccatggccatattcacagtcatcttcata
ttactggtggacctgatgcaccggcgccagcgctggacttctcgctaccctccaggccct
gtgccgtggcctgtgctgggcaacctgctgcaggtggacctctgtaacatgccatacagc
atgtacaagcttcaaaaccgctatggtgacgtgttcagcctacagatgggttggaagcca
gtggtggtgatcaatggactgaaggcagtgcaggaactgctggtgacctgtggagaggac
actgctgaccgccctgaaatgcccatctttcaacatataggctatgggcacaaagctaaa
ggtgtggtgcttgcaccttacgggcctgagtggcgagagcagaggcgattctctgtgtcc
accctgcgcaacttcggtgtgggcaagaaatccctggagcagtgggtgacagacgaggcc
agccacctctgtgatgccctcaccgctgaggcagggcggcccctcgatccttacaccctc
ctgaacaaggctgtgtgcaatgtaattgcatctctcatttatgcccgccgcttcgactat
ggagaccctgatttcatcaaggtgctaaaaatattgaaagaaagcatgggagagcaaact
ggcttgtttcctgaggttttgaacatgttcccagttctcctgcgcatcccagggttagct
gacaaagtcttccctgggcaaaagacatttctcaccatggtggataacctggtgactgag
cacaagaagacttgggaccctgaccagccacctcgagacctgactgatgcctttctggct
gagatagagaaggccaaggggaaccctgagagtagtttcaatgatgcaaatctacgtctg
gtggtcaatgacctgtttggtgctgggatggtgactacttctatcactctaacctgggcc
ctgctgctcatgatcctgcatccggatgtgcagtgccgagtacaacaggaaatcgatgag
gtcatagggcaggtgcggcatccagagatggcagaccaggcccacatgccgttcaccaat
gctgtcatccatgaggtgcagcgctttgcagacattgtcccaatgaatttgccacacaag
acttctcgtgacattgaagtgcagggcttccttatccctaaggggacaaccctcatcccc
aacctgtcctcagtgctgaaggatgagactgtctgggagaagcccctccgattccaccct
gaacacttcctggatgcccagggcaactttgtgaagcatgaggccttcatgccattctca
gcaggccgcagagcatgcctgggggagcccctggcccgcatggagctcttcctcttcttc
acctgcctcctgcaacgcttcagcttctccgtgcccactggacagccccggcccagcgac
tatggtgtctttgcctttctccttagcccttccccctaccagctctgtgcattcaaacgt
tag

DBGET integrated database retrieval system