KEGG   Rattus norvegicus (rat): 24306Help
Entry
24306             CDS       T01003                                 

Gene name
Cyp4a2, Cyp4a11
Definition
(RefSeq) cytochrome P450, family 4, subfamily a, polypeptide 2
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00071  Fatty acid degradation
rno00590  Arachidonic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno03320  PPAR signaling pathway
rno04270  Vascular smooth muscle contraction
rno04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    24306 (Cyp4a2)
   00590 Arachidonic acid metabolism
    24306 (Cyp4a2)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    24306 (Cyp4a2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    24306 (Cyp4a2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24306 (Cyp4a2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    24306 (Cyp4a2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rno00199]
    24306 (Cyp4a2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     24306 (Cyp4a2)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP4 family
   24306 (Cyp4a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 24306
NCBI-ProteinID: NP_001038235
RGD: 2479
Ensembl: ENSRNOG00000030154
UniProt: P20816
Position
5q35
AA seq 504 aa AA seqDB search
MGFSVFSPTRSLDGVSGFFQGAFLLSLFLVLFKAVQFYLRRQWLLKALEKFPSTPSHWLW
GHNLKDREFQQVLTWVEKFPGACLQWLSGSTARVLLYDPDYVKVVLGRSDPKPYQSLAPW
IGYGLLLLNGKKWFQHRRMLTPAFHYDILKPYVKIMADSVSIMLDKWEKLDDQDHPLEIF
HYVSLMTLDTVMKCAFSHQGSVQLDVNSRSYTKAVEDLNNLIFFRVRSAFYGNSIIYNMS
SDGRLSRRACQIAHEHTDGVIKTRKAQLQNEEELQKARKKRHLDFLDILLFAKMEDGKSL
SDEDLRAEVDTFMFEGHDTTASGISWVFYALATHPEHQERCREEVQSILGDGTSVTWDHL
DQMPYTTMCIKEALRLYSPVPSVSRELSSPVTFPDGRSIPKGIRVTILIYGLHHNPSYWP
NPKVFDPSRFSPDSPRHSHAYLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTR
IPVPMPRLVLKSKNGIHLRLKKLR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctctgtatttagccctacaagatccctggatggtgtctctgggttcttccaa
ggggccttcttgctcagtctatttctggtgctgttcaaggcagtccaattctacttacga
aggcaatggctgctcaaggccctcgagaagttcccatccacgccttcccactggctttgg
ggccacaacctgaaggatagagaattccagcaggttcttacgtgggtagagaaattccca
ggtgcctgcttacagtggctctcagggagcacagcacgagtcctgctctatgaccctgac
tatgtgaaggtggttctgggaagatcagatccaaagccttatcaatcccttgctccctgg
attggttatggtttgctcctgttgaatggaaagaaatggttccagcatcggcggatgttg
actccagccttccactatgacatcctcaaaccctatgtcaaaatcatggcggactctgtc
agtataatgctagacaaatgggagaagcttgatgaccaggatcaccctctagagatcttc
cactatgtctccttgatgacactggacactgttatgaagtgtgctttcagccaccagggc
agtgttcagttggatgtaaattccaggtcctacaccaaggctgttgaggatctaaacaac
ctgattttctttcgtgtgaggagtgccttttatgggaacagcatcatctacaatatgtcc
tctgatggccgtttgtcccgccgggcctgccagattgctcatgagcacacagatggagtg
atcaaaacgaggaaggctcagctgcagaatgaggaagagcttcagaaggccaggaagaag
aggcacttggatttcctggacatcctgttgtttgccaaaatggaggatgggaagagcttg
tcagatgaggacctgcgtgcagaggtggacacattcatgtttgagggtcatgacaccaca
gccagtggaatctcctgggttttctatgctctggccacccaccctgagcaccaagagaga
tgcagagaggaggtgcagagcattctgggtgatggaacctctgtcacatgggaccacctg
gaccagatgccttacaccaccatgtgcatcaaggaggccctgaggctctactcacctgta
ccttctgtgagtcgagagctcagctcccctgtcaccttcccagatggacgttccataccc
aaaggtatcagagtcacaattttaatttatggtcttcatcataacccaagttactggcca
aacccaaaggtgtttgacccctctagattctcaccagattctcctcgccatagccatgct
tatctgccattctcaggaggagcaaggaactgcattgggaaacaatttgccatgaatgag
ctgaaggtagctgtggccctgaccctgcttcgctttgagttgctgccagatcccaccagg
atcccggtccccatgccaagacttgtgttgaagtccaagaatgggatccacctgcgtctc
aagaagctaagataa

DBGET integrated database retrieval system