KEGG   Rattus norvegicus (rat): 24309Help
Entry
24309             CDS       T01003                                 

Gene name
Dbp
Definition
(RefSeq) D-box binding PAR bZIP transcription factor
  KO
K09056  albumin D box-binding protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24309 (Dbp)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   bZIP/PAR
    24309 (Dbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1
Motif
Other DBs
NCBI-GeneID: 24309
NCBI-ProteinID: NP_036675
RGD: 2491
Ensembl: ENSRNOG00000021027
UniProt: P16443
Position
1q22
AA seq 325 aa AA seqDB search
MARPLSDRTPGPLLLGGPAGAPPGGGALLGLRSLLQGNSKPKEPASCLLKEKERKATLPS
APVPGPVLETAGPADAPTGAVSGGGSPRGRSGPVAGPSLFAPLLWERTLPFGDVEYVDLD
AFLLEHGLPPSPPPPGGLSPAPSPARTPAPSPGPGSCSSSSPRSSPGHAPARATLGAAGG
HRAGLTSRDTPSPVDPDTVEVLMTFEPDPADLALSSIPGHETFDPRRHRFSEEELKPQPI
MKKARKVQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALLRQE
VVAVRQELSHYRAVLSRYQAQHGTL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcctctgagcgacaggaccccgggccccctgctgctgggtggcccggctggg
gccccccctggcgggggagcgctgcttgggctgaggagccttctgcagggaaacagcaag
cccaaagaaccggccagctgtctcctgaaggaaaaggagcgcaaggcaactctgccctca
gcccccgtcccgggacccgtcctggaaacggcgggcccagcggatgccccaactggggcg
gttagtggcggtgggtcccctcgggggcgctcagggcctgtggctggcccgagtcttttt
gcgccgctgctgtgggaacgcactttgcctttcggggacgtggaatacgtggacctggac
gccttcttgctggagcacgggctaccgccgagcccgccgccccccgggggcctgtcgccg
gcaccctctccagcgcgcactcccgcgccctcccccgggcccggctcttgcagctcctct
tccccccgctcctcgcccgggcacgcccccgcgcgggccactctgggagccgccggcggc
caccgcgcaggcttgacctctagggacacacccagtcctgtggacccagacaccgtggag
gtgctaatgacctttgaacctgatccggctgatcttgccctgtcaagcattccaggccat
gagacttttgaccctcggaggcaccgcttctcagaggaggaattgaagcctcagccaatc
atgaagaaggcaaggaaagtccaggtgcccgaggaacagaaggatgagaagtactggagc
cggaggtacaagaacaatgaagcagccaagaggtcgagagacgcaagaagactcaaggag
aaccagatatctgtgcgggcagccttcctggagaaggaaaacgccctattgcggcaggag
gtggtggctgtgcggcaggagctgtcccactaccgtgctgtgctttcacgctaccaggcc
caacacgggacactgtga

DBGET integrated database retrieval system