KEGG   Rattus norvegicus (rat): 24310
Entry
24310             CDS       T01003                                 

Gene name
Ace
Definition
(RefSeq) angiotensin-converting enzyme precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
rno04924  Renin secretion
rno05142  Chagas disease
rno05171  Coronavirus disease - COVID-19
rno05410  Hypertrophic cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    24310 (Ace)
   04614 Renin-angiotensin system
    24310 (Ace)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24310 (Ace)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    24310 (Ace)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    24310 (Ace)
   05415 Diabetic cardiomyopathy
    24310 (Ace)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24310 (Ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24310 (Ace)
   04090 CD molecules [BR:rno04090]
    24310 (Ace)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     24310 (Ace)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M2
   24310 (Ace)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24310 (Ace)
CD molecules [BR:rno04090]
 Proteins
  24310 (Ace)
SSDB
Motif
Pfam: Peptidase_M2 Peptidase_M32 DUF713 HupF_HypC
Other DBs
NCBI-GeneID: 24310
NCBI-ProteinID: NP_036676
RGD: 2493
Ensembl: ENSRNOG00000062101
Vega: OTTRNOG00000002214
UniProt: P47820
Position
10
AA seq 1313 aa
MGAASGQRGRWPLSPPLLMLSLLLLLLLPPSPAPALDPGLQPGNFSADEAGAQLFADSYN
SSAEVVMFQSTAASWAHDTNITEENARLQEEAALINQEFAEVWGKKAKELYESIWQNFTD
QKLRRIIGSVQTLGPANLPLTQRLQYNSLLSNMSRIYSTGKVCFPNKTATCWSLDPELTN
ILASSRNYAKVLFAWEGWHDAVGIPLKPLYQDFTALSNEAYRQDGFSDTGAYWRSWYESP
SFEESLEHLYHQVEPLYLNLHAFVRRALHRRYGDKYINLRGPIPAHLLGDMWAQSWENIY
DMVVPFPDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLSPMPPEFWAESMLEKPADG
REVVCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDLHVSLRRGANP
GFHEAIGDVLALSVSTPAHLHKIGLLDRVANDIESDINYLLKMALEKIAFLPFGYLVDQW
RWGVFSGRTPPSRYNYDWWYLRTKYQGICPPVARNETHFDAGAKFHIPSVTPYIRYFVSF
VLQFQFHQALCKEAGHQGPLHQCDIYQSTKAGAKLQQVLQAGCSRPWQEVLKDLVGSDAL
DASALMEYFQPVSQWLQEQNQRNGEVLGWPEYQWRPPLPDNYPEGIDLETDEAKANRFVE
EYDRTAKVLWNEYAEANWHYNTNITIEGSKILLQKNKEVSNHTLKYGTWAKTFDVSNFQN
STIKRIIKKVQNVDRAVLPPNELEEYNQILLDMETTYSVANVCYTNGTCLSLEPDLTNIM
ATSRKYEELLWVWKSWRDKVGRAILPFFPKYVDFSNKIAKLNGYSDAGDSWRSSYESDDL
EQDLEKLYQELQPLYLNLHAYVRRSLHRHYGSEYINLDGPIPAHLLGNMWAQTWSNIYDL
VAPFPSAPSIDATEAMIKQGWTPRRIFKEADNFFTSLGLLPVPPEFWNKSMLEKPTDGRE
VVCHASAWDFYNGKDFRIKQCTSVNMEELVIAHHEMGHIQYFMQYKDLPVTFREGANPGF
HEAIGDVLALSVSTPKHLHSLNLLSSEGSGYEHDINFLMKMALDKIAFIPFSYLIDQWRW
RVFDGSITKENYNQEWWSLRLKYQGLCPPVPRSQGDFDPGSKFHVPANVPYIRYFISFII
QFQFHEALCRAAGHTGPLYKCDIYQSKEAGKLLADAMKLGYSKQWPEAMKIITGQPNMSA
SAIMNYFKPLTEWLVTENRRHGETLGWPEYTWTPNTARAEGSLPESSRVNFLGMYLEPQQ
ARVGQWVLLFLGVALLVATVGLAHRLYNIHNHHSLRRPHRGPQFGSEVELRHS
NT seq 3942 nt   +upstreamnt  +downstreamnt
atgggggccgcgtccggccagcgggggcggtggccgttgtcaccgccgctcttgatgctg
tcgctgctgctgctgctgctgctgccgccgtcgcccgccccggcgcttgaccctggattg
cagccgggcaacttttccgcggacgaggcaggggcgcagctcttcgctgacagctataac
tcgagtgccgaggtggtgatgttccagagcaccgcagccagctgggcgcacgacaccaac
atcacggaggagaatgcgcggctccaggaggaagcggccctgatcaaccaggagtttgca
gaggtctggggcaagaaggccaaggagctgtatgagtccatctggcagaacttcactgac
caaaagctgcgaaggatcatcggatccgtacagaccctaggacctgccaacctgcccctg
acccagcggctgcagtacaactctctgctaagcaacatgagcagaatctactccaccggc
aaggtctgcttccccaacaagactgccacctgctggtccctggacccagagctcaccaac
atcctggcttcctcacgaaactatgccaaggtgctgtttgcctgggaaggctggcatgat
gctgtgggtatcccactgaagcccctctatcaggactttactgccctcagtaatgaagcc
tacagacaagatggcttctcagacacaggagcctactggcgctcctggtatgagtccccc
tcctttgaagagagtttggagcatctctaccaccaagtcgagcccctctacctgaacctc
catgcctttgtccgtcgcgcactgcaccgccgctatggggacaaatacatcaatctcaga
ggtcctattcccgctcatctgctgggagacatgtgggcgcagagctgggagaacatttac
gacatggtagtgcctttcccggacaaacccaacctcgatgtcaccagtacaatggtacag
aagggctggaatgccacgcacatgttccgggtcgcagaggaattctttacctcgctgggg
ctctcccccatgcctccagagttctgggcggagtcgatgctggagaaaccagctgatgga
cgggaggtggtgtgccatgcctctgcgtgggacttctacaacaggaaggacttcaggatt
aagcagtgcacgcgggtcacgatggaccagctgtccacagtacaccacgagatgggccac
gtgcagtactatctccagtacaaggacctgcacgtctctctgcgtcgaggtgccaaccct
ggcttccacgaggccatcggggatgtactcgctctctctgtctctaccccagcacatctg
cacaaaattggcctgctagaccgtgttgccaatgacatagaaagtgacatcaattacttg
ctaaagatggccctagagaaaattgccttcttgccctttggttacctggtggaccagtgg
cgctggggggtcttcagtggacgtaccccaccctctcgctacaactacgactggtggtat
cttcgaaccaagtatcaggggatctgcccaccagttgctcggaatgaaacccattttgac
gctggggccaagtttcacatcccaagcgtgacaccatacatcaggtactttgtgagtttc
gtgctacagttccagttccatcaagcgctgtgcaaggaggcaggccaccagggtccacta
caccagtgtgacatctaccagtccaccaaggcaggggccaagctccaacaggtgctgcag
gctggctgctccaggccctggcaggaggtgctgaaggacctggtgggttcagatgcgctg
gatgccagtgcgctaatggagtacttccaaccagtaagccagtggctgcaggagcagaat
cagcggaatggcgaggtcctaggctggccggagtatcagtggcgtccaccgttaccagac
aactatccagagggaattgacctagagactgatgaagccaaggctaacaggttcgtggag
gagtatgaccggacagccaaggtgttgtggaacgaatacgcagaggccaactggcattat
aacaccaacattaccatagagggcagcaagatcctgcttcagaaaaacaaggaagtgtcc
aaccataccttgaaatatggcacctgggccaagacatttgacgtgagcaacttccagaac
tctaccatcaagcggatcataaagaaggttcagaacgtggaccgggcagtgctgcctccc
aacgagttagaagagtacaaccagatcctgctagacatggagacgacttacagtgtagcc
aatgtttgctacacaaatggcacttgtctgtcactggagcctgatctgacaaatataatg
gccacgtcccggaaatacgaagaattgctttgggtgtggaagagctggcgagacaaggtg
gggagagccatccttccctttttcccaaagtacgtggacttctccaacaagatcgccaag
ctcaacggctactctgatgcaggggattcctggagatcctcatatgagtccgacgacttg
gagcaagacctggaaaaactataccaggagctgcagccgctctacctgaacctgcatgcc
tatgtgcgccgctccctgcaccgccattatgggtctgagtacatcaacctggatggtccc
attcctgctcacctgctagggaacatgtgggcacagacttggtccaacatctatgacttg
gtggcacccttcccttccgcccccagtatagatgccacggaggccatgataaagcaggga
tggacacccagaaggatatttaaggaagctgacaatttttttacctccctggggctgtta
cctgtgccccctgagttctggaacaagtcaatgttagagaagccaaccgatgggagggag
gtggtgtgccatgcctcagcctgggacttctacaacggcaaggacttcaggatcaagcag
tgtacctctgtgaacatggaggaattggtgatagcccaccacgaaatgggccacatccag
tatttcatgcagtacaaagacttgcctgtgacctttcgggagggcgccaaccccggtttt
catgaggctattggagatgttttggctctgtctgtgtctacacccaagcatctacacagt
ctcaacctgctcagcagtgagggcagtggctacgagcatgacatcaactttctaatgaag
atggcccttgacaagatcgccttcatccccttcagctacctcattgaccagtggcgctgg
agggtctttgacggaagcatcaccaaggagaactacaaccaggagtggtggagtctcaga
ctgaagtaccagggtctctgccctccagtgcctagatcccaaggtgactttgacccaggg
tccaagttccacgttcctgcgaatgtgccatacatcaggtactttatcagcttcatcatc
cagttccagttccacgaggcactatgtcgcgcagccgggcacaccggccccctgtacaag
tgtgatatctaccaatccaaggaagcagggaagctgctggcagatgccatgaagttgggc
tacagtaagcagtggccagaagccatgaagataatcacaggccaacctaacatgtcagcc
tctgccattatgaattacttcaagccactgactgaatggctcgtcacagagaacaggaga
catggagagacactgggctggccggagtacacctggacaccaaacacggctcgtgcagaa
ggctccctcccagagtccagtcgcgtcaacttcctgggtatgtacctggaaccacagcag
gcccgtgtgggccagtgggtgctgctcttcctaggcgtcgccctgctggtggccaccgtg
ggtctcgcccaccgactctacaacatccataaccatcacagcctccgccggccccaccgt
gggccccagtttgggtccgaggtggagctcagacactcctga

KEGG   Rattus norvegicus (rat): 498012
Entry
498012            CDS       T01003                                 

Gene name
Ace3
Definition
(RefSeq) angiotensin I converting enzyme (peptidyl-dipeptidase A) 3 precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04614  Renin-angiotensin system
rno04924  Renin secretion
rno05142  Chagas disease
rno05171  Coronavirus disease - COVID-19
rno05410  Hypertrophic cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    498012 (Ace3)
   04614 Renin-angiotensin system
    498012 (Ace3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    498012 (Ace3)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    498012 (Ace3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    498012 (Ace3)
   05415 Diabetic cardiomyopathy
    498012 (Ace3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    498012 (Ace3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    498012 (Ace3)
   04090 CD molecules [BR:rno04090]
    498012 (Ace3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     498012 (Ace3)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M2
   498012 (Ace3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   498012 (Ace3)
CD molecules [BR:rno04090]
 Proteins
  498012 (Ace3)
SSDB
Motif
Pfam: Peptidase_M2 AbiGi
Other DBs
NCBI-GeneID: 498012
NCBI-ProteinID: NP_001245166
RGD: 1561299
Ensembl: ENSRNOG00000007467
Vega: OTTRNOG00000002215
UniProt: M0RB66
Position
10
AA seq 737 aa
MGFPWAFLLVLLYYGQPLPWPKTVGEPSLDEFYSEAQAKMFLQFYEQTARVVLNELMEAT
WNYVTNITKQNQENMLQKEVERSQFMLYFGTRARMFRIDHFQDLDVKRRLSKLRNIDKSA
LPVEDFQEFNRLLTYMKTAYGRAEVCLDEGPCMPLEPDLEEIMATSRDQKELLWAWQGWR
DAIGRQLRPVFEDYVHLSNKAAQYNGYKDMGALWRSKYESDTLEEDLEQLYKELQPLYLN
LHAYVRRSLYRYYGPELIDLRGPIPAHLLGNMWAQSWNNILDLVLPYPNKPPEDITKIMK
NQHWRPEKMFEEANLFFTSMGMLPAPPAFWMKSMMEKPVDGREVECHTSSWNFYRLNDFR
VKKCTEVTIGDLLSIFHQMGHIQYYLQCQNLSIIYQEGASPAFEEAVGSTITLSAFSHKY
LLTRGLLSQQHQDSEEEVNFLLSIALEKIAFIPFGYMIDLFRWKVFDGTIQKNAYNQEWW
SLRLKYQGLCPPVPRSEDDFDPGAKFHIPANMPYIRYFLSLVLQFQLHEVLCRASGHVGP
LHRCDIYNSKVAGKILGDFLKVGSSRPWQEVLKEITGKPNISTKALLTYFKPLLNWLVTE
NVKQGDILGWPDFSCSFEEKITKKMSFLGMKIEPDQAYLGQWVLLSMSFIMLCLILALGL
RLHYLERRSLDSDTVILSTPPYAYFLGIAMEPRQAARKQWLLLGLCFVLMLCCIGLLIKI
FIHHTRKPPWMKAEWQS
NT seq 2214 nt   +upstreamnt  +downstreamnt
atgggctttccctgggccttcctacttgtgctcctctattacgggcagcccttgccgtgg
cccaagactgtgggagagccaagcttagatgagttctacagtgaagcccaagcaaagatg
ttcctgcagttttatgagcaaacagcccgagttgtgttgaacgagctcatggaggccact
tggaactatgtcaccaatatcaccaagcaaaatcaagagaacatgctgcagaaggaggtg
gagaggtcccagttcatgttgtactttggcacccgggcccgcatgtttaggatagaccat
ttccaggacctggacgtgaagcgcaggctgagtaagctgcggaacatagacaagtcggcc
ttgcccgtggaggatttccaggagttcaacagacttcttacctacatgaagacagcatac
ggtagagctgaggtgtgcctggatgagggtccatgcatgcccctggaacctgacctcgaa
gaaatcatggccacctccagggaccagaaggagctgctgtgggcctggcagggctggcgg
gatgccattggtcggcaactccgccctgtctttgaggactacgtacatctcagcaacaag
gctgcgcagtataatgggtacaaagacatgggggctttatggcgatccaagtatgagtct
gataccctggaggaagacctggaacagctctataaggagctgcagccgctctacctgaac
cttcacgcctacgtgcgccgctcactgtaccgctattacgggcctgagctcattgacctg
cgggggcccatccctgctcacctcctggggaacatgtgggctcagtcctggaacaatatc
ctagatctggtcctgccctatccaaataaacctcctgaggatatcacaaagatcatgaag
aatcagcactggaggcctgaaaagatgttcgaagaggctaatttattctttacctccatg
ggaatgctgcccgccccacctgctttctggatgaaatctatgatggagaagccagttgac
gggcgggaagtggagtgccacacctcatcctggaacttctataggctcaatgacttcagg
gtaaagaagtgcaccgaggtgaccataggagacctgctctccatcttccaccagatgggc
cacatccagtactacttgcagtgccagaacctctctataatctaccaagaaggcgccagc
ccagccttcgaagaggccgtggggtcaaccatcaccctctcagccttctcccacaagtac
ctgctcaccagaggtctgctcagccaacagcaccaggattcagaggaggaggtcaacttc
ctgttgagcatcgccctggagaagatcgccttcatccccttcggctacatgattgacctg
tttcgttggaaggtctttgacggcactattcagaagaacgcctacaaccaggagtggtgg
agcctcaggttgaagtaccaaggcctgtgcccgcctgtcccccggtcggaagatgatttt
gacccaggtgccaagttccacatccctgccaatatgccctacatccggtacttcctcagc
ctggtgctgcagttccaactccatgaagtactgtgcagggcctcaggccacgtgggtcct
ctgcaccggtgcgatatctataactccaaggtcgcagggaagattctgggggatttcctg
aaggtgggctccagccggccctggcaggaggtcctaaaggagataactggaaagcccaac
atatccaccaaggccctcttgacctacttcaagccgctgctgaactggctggtgactgaa
aacgtgaagcaaggggacatccttggctggccagacttcagctgctcttttgaagaaaaa
atcacaaagaaaatgtcatttctgggtatgaagatagagcctgaccaggcatacctgggg
cagtgggtgttgctaagcatgagttttatcatgctctgcctcatcctggcactgggcctc
aggttgcactacttggaaagacggtcactggacagcgacactgtgatacttagcaccccg
ccctatgcctacttcctgggcatagcgatggaaccccgccaggcggcccgaaaacagtgg
ctcctactgggcctctgcttcgtccttatgctgtgctgtattggcctcctcattaagata
ttcatacaccacaccaggaagcctccatggatgaaagctgaatggcagagctga

DBGET integrated database retrieval system