KEGG   Rattus norvegicus (rat): 24316Help
Entry
24316             CDS       T01003                                 

Gene name
Drd1, D1a, Drd-1, Drd1a
Definition
(RefSeq) dopamine receptor D1
  KO
K04144  dopamine receptor D1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04540  Gap junction
rno04728  Dopaminergic synapse
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05032  Morphine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24316 (Drd1)
   04024 cAMP signaling pathway
    24316 (Drd1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24316 (Drd1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24316 (Drd1)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    24316 (Drd1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24316 (Drd1)
  09165 Substance dependence
   05030 Cocaine addiction
    24316 (Drd1)
   05031 Amphetamine addiction
    24316 (Drd1)
   05032 Morphine addiction
    24316 (Drd1)
   05034 Alcoholism
    24316 (Drd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24316 (Drd1)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    24316 (Drd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF621
Motif
Other DBs
NCBI-GeneID: 24316
NCBI-ProteinID: NP_036678
RGD: 2518
Ensembl: ENSRNOG00000023688
UniProt: G3V933
Position
17p14
AA seq 446 aa AA seqDB search
MAPNTSTMDEAGLPAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTNF
FVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVDR
YWAISSPFQYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTWPLDGNFTSLED
TEDDNCDTRLSRTYAISSSLISFYIPVAIMIVTYTSIYRIAQKQIRRISALERAAVHAKN
CQTTAGNGNPVECAQSESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFISNCMVPFCGS
EETQPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFQKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNLVYLIPHAVGSSEDLKKEEAGGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPVTHSGQHST
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggctcctaacacttctaccatggatgaggccgggctgccagcggagagggatttctcc
tttcgcatcctcacggcctgtttcctgtcactgctcatcctgtccactctcctgggcaat
acccttgtctgtgcggccgtcatccggtttcgacacctgaggtccaaggtgaccaacttc
tttgtcatctctttagctgtgtcagatctcttggtggctgtcctggtcatgccctggaaa
gctgtggccgagattgctggcttttggccctttgggtccttttgtaacatctgggtagcc
tttgacatcatgtgctctacggcgtccattctgaacctctgcgtgatcagcgtggacagg
tactgggctatctccagccctttccagtatgagaggaagatgacccccaaagcagccttc
atcctgattagcgtagcatggactctgtctgtccttatatccttcatcccagtacagcta
agctggcacaaggcaaagcccacatggcccttggatggcaattttacctccctggaggac
accgaggatgacaactgtgacacaaggttgagcaggacgtatgccatttcatcgtccctc
atcagcttttacatccccgtagccattatgatcgtcacctacaccagtatctacaggatt
gcccagaagcaaatccggcgcatctcagccttggagagggcagcagtccatgccaagaat
tgccagaccaccgcaggtaacgggaaccccgtcgaatgcgcccagtctgaaagttccttt
aagatgtccttcaagagggagacgaaagttctaaagacgctgtctgtgatcatgggggtg
tttgtgtgctgctggctccctttcttcatctcgaactgtatggtgcccttctgtggctct
gaggagacccagccattctgcatcgattccatcaccttcgatgtgtttgtgtggtttggg
tgggcgaattcttccctgaaccccattatttatgcttttaatgctgacttccagaaggcg
ttctcaaccctcttaggatgctacagactctgccctactacgaataatgccatagagacg
gtgagcattaacaacaatggggctgtggtgttttccagccaccatgagccccgaggctcc
atctccaaggactgtaatctggtttacctgatccctcatgccgtgggctcctctgaggac
ctgaagaaggaagaggctggtggaatagctaagccactggagaagctgtccccagcctta
tcggtcatattggactatgacaccgatgtctctctagaaaagatccaacctgtcacacac
agtggacagcattccacttga

DBGET integrated database retrieval system