KEGG   Rattus norvegicus (rat): 24318Help
Entry
24318             CDS       T01003                                 

Gene name
Drd2
Definition
(RefSeq) dopamine receptor D2
  KO
K04145  dopamine receptor D2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04540  Gap junction
rno04728  Dopaminergic synapse
rno05012  Parkinson disease
rno05030  Cocaine addiction
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    24318 (Drd2)
   04024 cAMP signaling pathway
    24318 (Drd2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24318 (Drd2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    24318 (Drd2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    24318 (Drd2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    24318 (Drd2)
  09165 Substance dependence
   05030 Cocaine addiction
    24318 (Drd2)
   05034 Alcoholism
    24318 (Drd2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24318 (Drd2)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    24318 (Drd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 RIFIN
Motif
Other DBs
NCBI-GeneID: 24318
NCBI-ProteinID: NP_036679
RGD: 2520
Ensembl: ENSRNOG00000008428
UniProt: P61169
Position
8q23
AA seq 444 aa AA seqDB search
MDPLNLSWYDDDLERQNWSRPFNGSEGKADRPHYNYYAMLLTLLIFIIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRKRRKRVNTKRSSRAFRANLKTPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFMKILHC
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggatccactgaacctgtcctggtacgatgacgatctggagaggcagaactggagccgg
cccttcaatgggtcagaagggaaggcagacaggccccactacaactactatgccatgctg
ctcaccctcctcatctttatcatcgtctttggcaatgtgctggtgtgcatggctgtatcc
cgagagaaggctttgcagaccaccaccaactacttgatagtcagccttgctgtggctgat
cttctggtggccacactggtaatgccgtgggttgtctacctggaggtggtgggtgagtgg
aaattcagcaggattcactgtgacatctttgtcactctggatgtcatgatgtgcacagca
agcatcctgaacctgtgtgccatcagcattgacaggtacacagctgtggcaatgcccatg
ctgtataacacacgctacagctccaagcgccgagttactgtcatgattgccattgtctgg
gtcctgtccttcaccatctcctgcccactgctcttcggactcaacaatacagaccagaat
gagtgtatcattgccaaccctgcctttgtggtctactcctccattgtctcattctacgtg
cccttcatcgtcactctgctggtctatatcaaaatctacatcgtcctccggaagcgccgg
aagcgggtcaacaccaagcgcagcagtcgagctttcagagccaacctgaagacaccactc
aagggcaactgtacccaccctgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagaatggatgctgcccgccgagctcaggagctggaa
atggagatgctgtcaagcaccagtcccccagagaggacccggtatagccccatccctccc
agtcaccaccagctcactctccctgatccatcccaccacggcctacatagcaaccctgac
agtcctgccaaaccagagaagaatgggcacgccaagattgtcaatcccaggattgccaag
ttctttgagatccagaccatgcccaatggcaaaacccggacctcccttaagacgatgagc
cgcagaaagctctcccagcagaaggagaagaaagccactcagatgcttgccattgttctc
ggtgtgttcatcatctgctggctgcccttcttcatcacgcacatcctgaatatacactgt
gattgcaacatcccaccagtcctctacagcgccttcacatggctgggctatgtcaacagt
gccgtcaaccccatcatctacaccaccttcaacatcgagttccgcaaggccttcatgaag
atcttgcactgctga

DBGET integrated database retrieval system