KEGG   Rattus norvegicus (rat): 24323
Entry
24323             CDS       T01003                                 

Gene name
Edn1
Definition
(RefSeq) endothelin-1 preproprotein
  KO
K16366  endothelin-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04066  HIF-1 signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno04668  TNF signaling pathway
rno04916  Melanogenesis
rno04924  Renin secretion
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05200  Pathways in cancer
rno05410  Hypertrophic cardiomyopathy
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    24323 (Edn1)
   04066 HIF-1 signaling pathway
    24323 (Edn1)
   04024 cAMP signaling pathway
    24323 (Edn1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24323 (Edn1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    24323 (Edn1)
   04916 Melanogenesis
    24323 (Edn1)
   04924 Renin secretion
    24323 (Edn1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24323 (Edn1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24323 (Edn1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    24323 (Edn1)
   05410 Hypertrophic cardiomyopathy
    24323 (Edn1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    24323 (Edn1)
SSDB
Motif
Pfam: Endothelin PHD_3
Other DBs
NCBI-GeneID: 24323
NCBI-ProteinID: NP_036680
RGD: 2532
Ensembl: ENSRNOG00000014361
UniProt: P22388
Position
17
AA seq 202 aa
MDYFPVIFSLLFVAFQGAPETAVLGAELSPRAEKEVQSPPPSTSWRPRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPERVVPYGLGSPSRSKRSLKDLLPTKTTDQGNRCQCAHQKDKKC
WNFCQADKELRAQSTMQKGVKDFKKGKPCPKLGKKCIYQQLVEGRKLRRLEAISNSIKTS
FRVAKLKAELYRDQKLIHNRAH
NT seq 609 nt   +upstreamnt  +downstreamnt
atggattattttcccgtgatcttctctctgctgtttgtggctttccaaggagctccagaa
acagctgtcttgggagcagagctcagcccccgagctgagaaggaagtgcagagcccccct
cccagcacatcctggagaccccgcaggtccaagcgttgctcctgctcctccttgatggac
aaggagtgtgtctacttctgccacctggacatcatctgggtcaacactcccgagcgcgtc
gtcccgtatggactaggaagcccttctaggtctaagcgatccttgaaagacttacttccc
acaaagaccacagaccaagggaacagatgccagtgtgctcaccaaaaagacaagaagtgc
tggaatttctgccaagcagacaaagaactccgagcccaaagtaccatgcagaaaggcgta
aaagacttcaagaagggaaaaccctgtcccaagctgggaaagaagtgtatctatcagcag
ctggtggagggaagaaaactaagaaggttggaggccatcagcaacagcatcaagacctcc
tttcgagttgcaaagttgaaagcggaactctacagagaccagaagttgatacacaaccga
gcacattga

KEGG   Rattus norvegicus (rat): 24324
Entry
24324             CDS       T01003                                 

Gene name
Edn2
Definition
(RefSeq) endothelin-2 precursor
  KO
K16367  endothelin-2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    24324 (Edn2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24324 (Edn2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    24324 (Edn2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24324 (Edn2)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 24324
NCBI-ProteinID: NP_036681
RGD: 2533
Ensembl: ENSRNOG00000009390
UniProt: G3V771
Position
5
AA seq 176 aa
MVSPAWCSIALALLLALHEGKGQAAATMEQPASAPKGRGPHLRFRRCSCNSWLDKECVYF
CHLDIIWVNTAGQTAPYGLGNPPRRRRRSLPKRCECSSAGDSACATFCHRRPWPEAEVTS
SSQGPAAVLETSKTWTAAGDLLQKLRDISAAKLQFVRLRPELTREAIPAHSRRRKR
NT seq 531 nt   +upstreamnt  +downstreamnt
atggtctccccggcctggtgttccattgctctggccctacttttggccctgcatgaaggg
aagggccaggcagctgctaccatggagcaaccagcctcggcacccaagggccgaggaccc
cacctgcgttttcgtcgttgctcctgcaactcctggcttgacaaggaatgtgtgtacttc
tgccacctggacatcatctgggtgaacactgcaggacagacagctccctatggcctggga
aacccgccaaggcgccggcgccgctccctgccaaagcgctgcgagtgctcttctgctggg
gactctgcctgtgccaccttctgccatcgaaggccctggcctgaagctgaggtcacctca
agtagccagggccctgctgctgtgttagagactagcaagacgtggactgctgcgggagac
cttctccaaaagctgagggacatctcagctgccaagctccaatttgtcaggctacggcca
gagttgacaagagaggccatccctgcacactctagacggaggaagagataa

KEGG   Rattus norvegicus (rat): 366270
Entry
366270            CDS       T01003                                 

Gene name
Edn3
Definition
(RefSeq) endothelin-3 precursor
  KO
K05227  endothelin-3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    366270 (Edn3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    366270 (Edn3)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    366270 (Edn3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    366270 (Edn3)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 366270
NCBI-ProteinID: NP_001071118
RGD: 2534
Ensembl: ENSRNOG00000007477
UniProt: P13207
Position
3
AA seq 167 aa
MELGLWLLLGLTVTSAAAALPAQPGNAGQERGPGRSGDQEEKRVPAHHRPRRCTCFTYKD
KECVYYCHLDIIWINTPEQTVPYGLSNHRGSLRGKRSSGPVPESSQSSPQTRLRCACAGV
DDKACAYFCAHVTSYSRRAEKAAAEEKQETGGPRQRLKSRTDKVHQP
NT seq 504 nt   +upstreamnt  +downstreamnt
atggagctggggctgtggctccttctcgggctcacagtgacctccgctgcagctgcactg
cctgcacagcctggaaatgctgggcaggagcggggaccaggcaggtctggggaccaggag
gaaaagagggtgcctgcacaccaccgacctcggcgctgcacgtgcttcacttataaggac
aaggagtgtgtctactactgccacctggacatcatctggatcaacactcctgaacagact
gtgccctatggactgtccaaccacagaggaagcctccggggaaagaggtcctcggggcca
gttccagaaagttcccagtcttctccacagacacgcttacgttgtgcctgtgcaggggtg
gatgacaaggcctgcgcatacttctgtgcacacgtcaccagttattccaggagagcagaa
aaggcagctgcagaagagaagcaggagactggaggtccacgtcaaaggctgaagtcaagg
acagataaagtccaccagccttag

DBGET integrated database retrieval system