KEGG   Rattus norvegicus (rat): 24326Help
Entry
24326             CDS       T01003                                 

Gene name
Ednra, ET-A, ET-AR, Endor, Eta, RGD1559432
Definition
(RefSeq) endothelin receptor type A
  KO
K04197  endothelin receptor type A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04270  Vascular smooth muscle contraction
rno04924  Renin secretion
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    24326 (Ednra)
   04024 cAMP signaling pathway
    24326 (Ednra)
   04022 cGMP-PKG signaling pathway
    24326 (Ednra)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    24326 (Ednra)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    24326 (Ednra)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    24326 (Ednra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24326 (Ednra)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    24326 (Ednra)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Peptide
   Endothelin
    24326 (Ednra)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 24326
NCBI-ProteinID: NP_036682
RGD: 2535
Ensembl: ENSRNOG00000012721
UniProt: P26684 A1Y2B8 A0A0G2JSX5
Position
19q11
AA seq 426 aa AA seqDB search
MGVLCFLASFWLALVGGAIADNAERYSANLSSHVEDFTPFPGTEFDFLGTTLRPPNLALP
SNGSMHGYCPQQTKITTAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLITAIEIVSIWILSFILAIPEAIGFVMVPFEYKGEQHRTCM
LNATTKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYDEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCHQSKSLMTSVPMNGTSIQWKNQEQNHNTERSS
HKDSMN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcctttgctttctggcgtccttttggctggccctggtgggaggcgcaatcgct
gacaatgctgagagatacagtgctaatctaagcagccacgtggaggacttcacccctttt
ccagggacagagttcgactttctgggcaccacccttcgaccccctaatttggccctgcct
agcaatggctcaatgcatggctattgcccacagcagacaaaaatcacgacggctttcaaa
tatatcaacactgtgatatcctgtaccattttcatcgtgggaatggtggggaacgccact
ctcctaagaatcatttaccaaaacaagtgtatgaggaacggccccaatgcgctcatagcc
agcctggcccttggagaccttatctacgtggtcattgatctccccatcaatgtgtttaag
ctgttggcggggcgctggccttttgaccacaatgattttggagtgtttctctgcaagctg
ttcccctttttgcagaagtcgtccgtgggcatcactgtcctgaatctctgcgctctcagt
gtggacaggtacagagcagtggcttcctggagccgggttcaaggaatcgggatccccttg
attaccgccattgaaattgtctccatctggatcctttcctttatcttggccatcccagaa
gcaatcggcttcgtcatggtacccttcgaatacaagggcgagcagcacaggacctgcatg
ctcaacgccacgaccaagttcatggagttttaccaagacgtgaaggactggtggctcttt
ggattctacttctgcatgcccttggtgtgcacagcaatcttctataccctcatgacctgt
gagatgctcaacagaaggaatgggagcttgcggattgccctcagcgaacacctcaagcag
cgtcgagaggtggcaaagaccgtcttctgcttggttgtcatcttcgccctgtgctggttc
cctcttcacttaagccgaattttgaagaaaaccgtctatgatgagatggataagaaccgg
tgtgaactgctcagcttcttgctgctcatggattacattggcattaacctggcaaccatg
aactcttgcataaacccaatagctctgtattttgtgagcaagaaattcaaaaattgtttt
cagtcatgcctctgttgctgttgtcaccagtccaaaagcctcatgacctcggtccccatg
aatggaacgagtatccagtggaagaaccaggagcagaaccacaacacagaacggagcagc
cacaaggacagcatgaactaa

DBGET integrated database retrieval system