KEGG   Rattus norvegicus (rat): 24329
Entry
24329             CDS       T01003                                 

Gene name
Egfr
Definition
(RefSeq) epidermal growth factor receptor precursor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04020  Calcium signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04072  Phospholipase D signaling pathway
rno04144  Endocytosis
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04540  Gap junction
rno04630  JAK-STAT signaling pathway
rno04810  Regulation of actin cytoskeleton
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno04926  Relaxin signaling pathway
rno04928  Parathyroid hormone synthesis, secretion and action
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05171  Coronavirus disease - COVID-19
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05230  Central carbon metabolism in cancer
rno05231  Choline metabolism in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    24329 (Egfr)
   04012 ErbB signaling pathway
    24329 (Egfr)
   04014 Ras signaling pathway
    24329 (Egfr)
   04015 Rap1 signaling pathway
    24329 (Egfr)
   04630 JAK-STAT signaling pathway
    24329 (Egfr)
   04066 HIF-1 signaling pathway
    24329 (Egfr)
   04068 FoxO signaling pathway
    24329 (Egfr)
   04020 Calcium signaling pathway
    24329 (Egfr)
   04072 Phospholipase D signaling pathway
    24329 (Egfr)
   04151 PI3K-Akt signaling pathway
    24329 (Egfr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    24329 (Egfr)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    24329 (Egfr)
   04520 Adherens junction
    24329 (Egfr)
   04540 Gap junction
    24329 (Egfr)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    24329 (Egfr)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    24329 (Egfr)
   04915 Estrogen signaling pathway
    24329 (Egfr)
   04921 Oxytocin signaling pathway
    24329 (Egfr)
   04926 Relaxin signaling pathway
    24329 (Egfr)
   04928 Parathyroid hormone synthesis, secretion and action
    24329 (Egfr)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24329 (Egfr)
   05206 MicroRNAs in cancer
    24329 (Egfr)
   05205 Proteoglycans in cancer
    24329 (Egfr)
   05230 Central carbon metabolism in cancer
    24329 (Egfr)
   05231 Choline metabolism in cancer
    24329 (Egfr)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    24329 (Egfr)
  09162 Cancer: specific types
   05210 Colorectal cancer
    24329 (Egfr)
   05212 Pancreatic cancer
    24329 (Egfr)
   05225 Hepatocellular carcinoma
    24329 (Egfr)
   05226 Gastric cancer
    24329 (Egfr)
   05214 Glioma
    24329 (Egfr)
   05218 Melanoma
    24329 (Egfr)
   05219 Bladder cancer
    24329 (Egfr)
   05215 Prostate cancer
    24329 (Egfr)
   05213 Endometrial cancer
    24329 (Egfr)
   05224 Breast cancer
    24329 (Egfr)
   05223 Non-small cell lung cancer
    24329 (Egfr)
  09172 Infectious disease: viral
   05160 Hepatitis C
    24329 (Egfr)
   05171 Coronavirus disease - COVID-19
    24329 (Egfr)
   05163 Human cytomegalovirus infection
    24329 (Egfr)
   05165 Human papillomavirus infection
    24329 (Egfr)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24329 (Egfr)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    24329 (Egfr)
   01522 Endocrine resistance
    24329 (Egfr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    24329 (Egfr)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24329 (Egfr)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     24329 (Egfr)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   24329 (Egfr)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   24329 (Egfr)
  Exosomal proteins of pancreatic cancer cells
   24329 (Egfr)
  Exosomal proteins of bladder cancer cells
   24329 (Egfr)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like ABC1
Other DBs
NCBI-GeneID: 24329
NCBI-ProteinID: NP_113695
RGD: 2543
Ensembl: ENSRNOG00000004332
UniProt: Q9QX70
Position
14
AA seq 1209 aa
MRPSGTARTKLLLLLAALCAAGGALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNALYENTYALA
VLSNYGTNKTGLRELPMRNLQEILIGAVRFSNNPILCNMETIQWRDIVQDVFLSNMSMDV
QRHLTGCPKCDPSCPNGSCWGRGEENCQKLTKIICAQQCSRRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCHRFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGPDYYEVEEDGVSKCKKCDGPCRKVCNGIGIGEFKDTLSINATNIKHFK
YCTAISGDLHILPVAFKGDSFTRTPPLDPRELEILKTVKEITGFLLIQAWPENWTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLNITSLGLRSLKEISDGDVIISGNRNLCYANTINWKKL
FGTPNQKTKIMNNRAEKDCKATNHVCNPLCSSEGCWGPEPTDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQTMNITCTGRGPDNCIKCAHYVDGPHCVKTCPSGIM
GENNTLVWKFADANNVCHLCHANCTYGCAGPGLKGCQQPEGPKIPSIATGIVGGLLFIVV
VALGIGLFMRRRQLVRKRTLRRLLQERELVEPLTPSGEAPNQAHLRILKETEFKKIKVLG
SGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLG
ICLTSTVQLITQLMPYGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLA
ARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWS
YGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRP
KFRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMEEEDMEDVVDADEYLIP
QQGFFNSPSTSRTPLLSSLSANSNSSTVACINRNGSCRVKEDAFLQRYSSDPTSVLTEDN
IDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLHPAPGRDLHYQNPHSNAVSNPEYLNT
AQPTCLSSGFDSSALWIQKGSHQMSLDNPDYQQDFFPKEAKPNGIFKGPTAENAEYLRVA
PPSSEFSGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgaccctcagggactgcgagaaccaagctactgctgctgctggctgcgctctgcgcc
gcaggtggggcgctggaggaaaagaaagtttgccaaggcacaagtaacaggctcacccaa
ctaggcacctttgaagaccactttctgagcctccagaggatgttcaacaactgtgaagtg
gtccttggaaacttggaaatcacctatgtgcaaaggaattatgacctttccttcttaaag
accatccaggaggtggctggctatgttctcattgccctgaacaccgtggagagaatccct
ttggagaacctgcagatcatcaggggaaatgctctctacgaaaacacctacgccttagcc
gtcctgtccaactatggaaccaacaaaactgggcttagggaactgcccatgcggaactta
caggaaattctgatcggtgctgtgcgatttagcaacaaccccatcctctgcaatatggag
accatccagtggagggacatcgtccaagatgtctttctgagcaacatgtcaatggacgta
cagcgccacctgacgggctgcccgaaatgtgatccgagctgtcccaatggaagctgctgg
ggaagaggagaggagaactgccagaaattgaccaaaatcatctgcgcccagcaatgttcc
cggcgttgtcgtggcaggtcccctagcgactgctgccacaaccagtgtgccgcagggtgt
acagggcccagagagagtgactgtctggtctgccacaggttccgagatgaagccacgtgc
aaagacacctgcccaccactcatgctgtacaaccccaccacgtaccagatggatgtcaac
cctgaggggaagtacagctttggtgccacctgtgtgaagaaatgccccagaaactacgtg
gtgacagatcacggctcgtgtgtccgggcctgtgggccagactactatgaagtagaagaa
gatggagtcagcaagtgtaaaaaatgtgacgggccctgccgcaaagtttgcaatggcata
ggcattggtgaatttaaagacacactctccataaatgctacaaacatcaaacacttcaag
tactgcactgccatcagtggggacctccacatcctgccagtggcctttaagggggattct
ttcacccgcactcctcctctagacccacgggaactagaaattctcaaaactgtgaaggaa
ataacagggtttttgctgattcaggcttggcctgaaaactggactgacctccatgctttt
gagaacctagaaataattcgtggcagaacaaagcaacatggtcagttttctctggcggtt
gtcggcctgaacataacatcgctggggttgcgttccctcaaggagatcagtgatggggat
gtgattatttctgggaaccgaaatttgtgctacgcaaacactataaactggaaaaaactc
ttcgggacgcccaatcaaaagaccaaaatcatgaacaacagagctgaaaaggactgcaag
gccacgaaccacgtctgtaatcctttatgctcctcggaaggctgctggggccctgagccc
acggactgtgtctcctgccagaatgtgagcagaggcagggagtgcgtggacaagtgcaac
atcctggagggggaaccgagggagtttgtggaaaattctgaatgcatccagtgccatcca
gaatgtctgccccagaccatgaacatcacctgtacaggccgggggccagacaactgcatc
aagtgtgcccactatgttgatggtccccactgtgtcaagacctgcccttcgggcatcatg
ggggagaacaacaccctggtctggaagtttgcagatgccaataacgtctgccacctctgc
catgcaaactgtacctatggatgtgctgggccaggccttaaaggatgtcaacaaccagaa
gggccaaagatcccatccatcgccactgggattgtgggtggcctcctcttcatagtagtg
gtggcccttgggatcggcctcttcatgcgtcgacgtcagcttgtccgaaaacgtacacta
cgccgcctgcttcaagagagagagctcgtggaacctctcacacccagcggagaagctccg
aaccaagcccacttgaggatattaaaggaaacagaattcaaaaagatcaaagttctgggt
tcaggagcatttggcacagtgtataagggtctctggatcccagaaggcgagaaagtgaaa
atccctgtggccatcaaggagttaagagaagccacatctcccaaagccaacaaggaaatc
cttgatgaagcctacgtgatggccagtgtggacaaccctcatgtatgccgcctcctgggc
atctgtctgacctccactgtccagctcattacacaactcatgccctatggttgcctcctg
gactatgtccgagaacataaggacaacattggctcccagtacctactcaactggtgtgtg
cagattgcaaagggcatgaactacctggaagaccggcgtttggtacaccgtgacttggca
gccaggaatgtactggtaaagacaccacagcatgtcaagatcacagattttggactggcc
aaactgcttggtgctgaggagaaagaataccatgcagaggggggcaaagtgcctatcaag
tggatggctttggaatcaattttacaccgaatttatacacaccaaagcgacgtctggagc
tatggagtcaccgtgtgggaactgatgacctttgggtccaagccttatgatgggatccct
gcaagtgagatctcatccatcctagagaaaggagagcgccttccacagccacctatctgc
accatcgacgtctacatgatcatggtcaagtgctggatgatagatgctgatagccgccca
aagttccgagagttgattctcgaattctccaaaatggccagagacccacagcgctacctt
gttatccagggggatgaaaggatgcatttgccgagccctacagactccaacttttaccga
gccctgatggaggaggaggacatggaagacgtagttgatgctgatgaatacctcatccca
cagcaaggcttcttcaacagcccatccacgtcacggactccactcttgagctctctgagt
gcaaatagcaacagttccactgtggcttgcattaatagaaatgggagctgccgtgtcaaa
gaagacgccttcttgcaacggtatagctccgatcccaccagcgtcctgacagaggacaac
atagatgacacattccttcccgtgcctgaatatataaaccaatctgttcccaagaggccg
gctggctctgtgcagaacccagtctatcacaatcagcccctgcatccagctcctggaaga
gacctgcattatcaaaatccccatagcaatgcggtgagcaaccctgagtatctcaacact
gcccagccgacctgcctcagtagtgggtttgacagctctgccctctggatccagaaaggc
agccaccaaatgagcctggacaaccctgactaccagcaggacttctttcccaaagaagcc
aagccgaatggcatctttaagggccccacagctgaaaatgcagagtacctgcgggtggca
ccgccaagcagtgagtttagtggagcatga

DBGET integrated database retrieval system