KEGG   Rattus norvegicus (rat): 24356
Entry
24356             CDS       T01003                                 

Gene name
Ets1
Definition
(RefSeq) protein C-ets-1
  KO
K02678  C-ets-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04014  Ras signaling pathway
rno04218  Cellular senescence
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    24356 (Ets1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    24356 (Ets1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24356 (Ets1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    24356 (Ets1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    24356 (Ets1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    24356 (Ets1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    24356 (Ets1)
SSDB
Motif
Pfam: Ets1_N_flank SAM_PNT Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 24356
NCBI-ProteinID: NP_036687
RGD: 2583
Ensembl: ENSRNOG00000008941
UniProt: P41156
Position
8
AA seq 441 aa
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGVNPTYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQTDYFAIKQEVLTPDNMCMGR
ASRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaagccgactctcaccatcatcaagacagaaaaagtggat
ttggagcttttcccatccccggatatggaatgcgcagatgtcccactgttaactccgagc
agcaaagaaatgatgtcccaggcactgaaagctaccttcagtggtttcacaaaagagcag
cagcgactgggaatccccaaagacccccggcagtggacagaaacccatgtccgggattgg
gtgatgtgggctgtgaatgagttcagcctgaagggtgtggacttccagaagttctgtatg
aatggagcagcactgtgtgccctgggtaaagaatgcttcctcgagctggctccagacttt
gtgggggatatcctgtgggagcatctagagatcctgcagaaagaggatgtgaaaccgtat
caggttaatggagtcaaccctacctacccagaatcccgttacacctcggattacttcatt
agctatggtatcgagcatgctcagtgtgtccctccctcagagttctcagagcccagcttc
atcacagagtcctatcagacgctgcatcccatcagctcggaagaactcctgtccctcaag
tatgagaacgactacccttccgtcattctccgggaccctctccagacagacaccttgcag
acagactactttgccatcaagcaagaagtgttaactccagacaacatgtgcatggggaga
gccagtcgtggtaaactcgggggccaggactcttttgagagcatagagagctacgatagt
tgtgaccgtctcacccagtcctggagcagccagtcatctttcaacagcctgcagcgtgtc
ccctcctatgacagcttcgactccgaggactatcccgctgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgtgaccgtgctgacctcaacaaggacaagcctgtc
attcctgctgctgccctggctggctacacaggaagtgggccgatccagctgtggcagttt
cttctggaattactcactgataagtcttgtcagtcttttatcagctggacaggagacggc
tgggaattcaagctttccgacccagatgaggtggccaggagatggggaaagaggaaaaac
aagcctaagatgaattatgagaaactgagccgcggccttcgctactattacgacaaaaat
atcatccacaagacggcgggcaagcgctacgtgtaccgctttgtctgcgacctacagagc
ctgctgggatacaccccagaggagctgcatgccatgctggatgtgaagccggatgctgat
gagtaa

DBGET integrated database retrieval system