KEGG   Rattus norvegicus (rat): 24361Help
Entry
24361             CDS       T01003                                 

Gene name
Fancc, Facc
Definition
(RefSeq) Fanconi anemia, complementation group C
  KO
K10890  fanconi anemia group C protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    24361 (Fancc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    24361 (Fancc)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     24361 (Fancc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fanconi_C
Motif
Other DBs
NCBI-GeneID: 24361
NCBI-ProteinID: NP_036689
RGD: 2593
Ensembl: ENSRNOG00000016889
UniProt: B4F762
Position
17p14
AA seq 557 aa AA seqDB search
MAQEPADLASDYQFWLQKLSAWEQASSKETQRDTCLHLSRFQEFLRQMYELLKEMDSDAI
LERFPSIGQLLAKTCWNPLILAYDESQKIVIWCLCCLMNKAPRTSAESGRNSWIQGLLSH
VLSAFRFDMKEVCLFTKSLGYESIDYYPSLLKNMVLSLVSELRGSHLNGLNTQSRMAPER
MMSLSQVCVPLVTLPDIEPLVEALLTYHGHEPQEVLSAEFFEAVTEAFLSEKIVLPTSSV
VSLWFRHLPSLEKATLHLFEKLFSSKRNCLRRMECCIKESLLPQAACQPAIFRIVDEMFR
FVLLETDGAPAVLAALQIFTSCLVEALRKENKQLKFALKTYFPYSAPCLTAALSQQPEAI
PQGHRLQPLLHISQLLREAVEDCTDGSHRNPFESWFLFVHFGGWVDLAVEELLLREEAEP
PAGLLWLLVFYYSPQDRSQQREQSMVELKVLVNRLLKLLRSGPLSAMDLLEAAESPREDP
RPVCGQLVRRLLLSLLFWTPEGHAIVWEAVTHMAHTDAVTHEIVGFLDQTLYRSHHLCVE
ASRKLARELLKELQAQV
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggagcctgcagaccttgcttctgactatcagttttggctgcagaagctttct
gcatgggaacaggcctcttccaaggagacccagcgggacacttgtcttcacttgtcccgg
ttccaagagttcctgaggcagatgtatgaactcttgaaggagatggattctgatgcaatc
ctggaacggttcccctcaattggtcaactgttggcaaaaacttgttggaatcctctcatc
ttggcatatgacgaaagccaaaagattgtaatatggtgcttatgttgtctgatgaacaaa
gcaccacggacttctgcagagtcaggacgtaactcatggatccagggtttgttgtctcat
gtactttctgcattcagattcgacatgaaagaagtttgtctttttaccaaaagtcttgga
tatgaatctattgattactatcctagtttgcttaaaaatatggttttgtcgttagtgtct
gagctcagagggagtcatcttaatggactgaacactcaaagtcggatggctcctgagcgc
atgatgtccctgtcacaagtctgtgtccctcttgttactctgcctgatattgaacccctg
gtagaggctctcctaacctaccatggacatgagccccaagaagtcctgtctgctgagttc
tttgaagctgtaactgaggccttcttatcggaaaaaattgtcctgcccacgtcctctgtg
gtcagcctctggtttcggcatctccccagccttgaaaaagcaacgctgcatctttttgaa
aagctgttctccagcaagagaaattgcctgagaaggatggagtgctgtataaaagagtca
ttactgcctcaagcagcctgccaacctgccatctttagaattgttgatgaaatgttcagg
tttgtgctactggaaactgatggggccccagcagtgctagctgctcttcagattttcaca
tcctgcttggtagaagctctgaggaaagaaaacaagcagctgaagtttgccctcaagacc
tactttccctacagtgctccgtgtcttactgcagcgctgtcccagcagcctgaagctatc
ccacagggacatcggctccagcctctgctgcacatttcccaactcctcagagaagcagtt
gaagactgtactgatgggtctcatcgaaatccctttgagagctggtttttgtttgttcac
tttggaggatgggttgatctggctgtggaggagttgctgctcagggaggaagctgagcct
cctgcaggccttctgtggctcttggtcttctattacagcccacaggacaggagtcagcag
agagagcagagcatggtggagttgaaggtattagtcaaccgtctcctgaagctgctcaga
agtggccccctctcagctatggacctgctggaagcagctgagagccccagggaagacccc
agacctgtatgtggacagctggtcagacgccttcttcttagtctcttgttctggacccca
gaaggccatgcgattgtctgggaagctgtcacccatatggcccacacagatgctgtaacc
cacgagattgttggctttcttgaccagaccttgtacagatcacatcatctttgtgttgaa
gcctcaagaaaactggctagagagctcctaaaggagctgcaagctcaggtctag

DBGET integrated database retrieval system