KEGG   Rattus norvegicus (rat): 24366
Entry
24366             CDS       T01003                                 

Gene name
Fgb
Definition
(RefSeq) fibrinogen beta chain precursor
  KO
K03904  fibrinogen beta chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24366 (Fgb)
   04611 Platelet activation
    24366 (Fgb)
   04613 Neutrophil extracellular trap formation
    24366 (Fgb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24366 (Fgb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24366 (Fgb)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24366 (Fgb)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   24366 (Fgb)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   24366 (Fgb)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   24366 (Fgb)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha CALCOCO1 FANCI_S2
Other DBs
NCBI-GeneID: 24366
NCBI-ProteinID: NP_064456
RGD: 2604
Ensembl: ENSRNOG00000007092
Vega: OTTRNOG00000001393
UniProt: P14480
Position
2
AA seq 479 aa
MRHLWLLLLSVSLVQTQAATTDSDKVDLSIARGHRPVDRRKEEPPSLRPAPPPISGGGYR
ARPAKVDAGQKKVERKPPDAGGCVHGDGDMGVLCPTGCELRQTLLNHERPIKNSIAELNS
NINSVSETSSVTFQYLTLLKDMWKKKQAQVKDNENVINEYSSILEDQKLYIDETVNDNIP
LNLRVLRSILEDLRSKIQKLESDISAQTEYCHTPCTVNCNIPVVSGKECEEIIRKGGETS
EMYLIQPDTSSKPYRVYCDMKTENGGWTVIQNRQDGSVDFGRKWDPYKKGFGNIATNEDT
KKYCGLPGEYWLGNDKISQLTRIGPTELLIEMEDWKGDKVKAHYGGFTVQTEANKYQVSV
NKYKGTAGNALMEGASQLVGENRTMTIHNGMFFSTYDRDNDGWVTTDPRKQCSKEDGGGW
WYNRCHAANPNGRYYWGGLYSWDMSKHGTDDGVVWMNWKGSWYSMRRMSMKIRPVFPQQ
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaggcatctatggctgctgctcctgtctgtttccttagttcaaactcaagctgcaact
actgactccgataaagtggacctctcgattgcccgtggtcatcgacctgttgacaggaga
aaggaagagcctcctagcctaagacctgcccctcctcctatcagcggaggtggctatcga
gcccgtccagccaaagttgatgcaggtcagaagaaagtggaacgaaaaccccctgatgca
ggaggctgtgttcacggtgacggagacatgggagtgctatgtcctacagggtgtgagttg
cgtcaaactttgctaaaccacgaaaggccaatcaaaaacagtattgctgagttaaatagc
aacataaactctgtttctgagacctcttcggtcacctttcagtacctgactctgctgaaa
gacatgtggaaaaagaagcaggcacaagttaaagataatgaaaatgtcataaatgagtat
tcctccattttggaagaccagaaattatatattgatgagactgtgaacgataatatcccc
cttaatcttcgtgtgctccgctcaatcctggaggacctgagaagcaaaatacaaaaattg
gagtctgacatctcagctcagacggaatactgccacactccatgcaccgtcaactgcaac
atcccggtggtgtctgggaaagagtgtgaagagatcattcggaagggaggtgagacatcc
gaaatgtatctcattcagcctgacacctccagcaaaccatacagagtgtactgcgacatg
aagaccgaaaacggaggatggacggtcatacagaaccgtcaggatggcagcgtcgacttt
ggcaggaaatgggacccatacaaaaaaggatttggaaatattgcaaccaacgaagatacg
aagaagtactgtggcttgccaggcgaatattggcttggcaatgataagattagccagctc
accaggataggacccacagaactcctaatcgaaatggaggactggaaaggagacaaggtg
aaggcacactatggaggcttcacggtgcagaccgaggccaacaagtaccaagtgtcagtg
aacaagtacaaagggactgctggcaacgccctcatggaaggggcctctcagctggtgggg
gagaacagaaccatgaccatccacaacggcatgttcttcagcacctacgacagggacaac
gatggctgggtaactacagatccaagaaagcagtgctcaaaagaagatggcggcggctgg
tggtataacagatgccatgcagccaatccgaatggcagatactactggggtggcctttac
agctgggacatgtccaagcacggcacagatgatggtgtggtgtggatgaactggaaggga
tcgtggtactccatgagaaggatgtctatgaagatcaggcccgtcttcccacagcaatag

KEGG   Rattus norvegicus (rat): 24367
Entry
24367             CDS       T01003                                 

Gene name
Fgg
Definition
(RefSeq) fibrinogen gamma chain precursor
  KO
K03905  fibrinogen gamma chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    24367 (Fgg)
   04611 Platelet activation
    24367 (Fgg)
   04613 Neutrophil extracellular trap formation
    24367 (Fgg)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    24367 (Fgg)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    24367 (Fgg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24367 (Fgg)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    24367 (Fgg)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24367 (Fgg)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   24367 (Fgg)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   24367 (Fgg)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha MscS_porin Spc29 Csm1_N
Other DBs
NCBI-GeneID: 24367
NCBI-ProteinID: NP_036691
RGD: 2613
Ensembl: ENSRNOG00000025074
UniProt: P02680
Position
2
AA seq 437 aa
MNWSLQLRSFILCWALLLLSPTGLAQYTATRDNCCILDERFGSYCPTTCGISDFLNSYQT
DVDTDLQTLENILQRAENRTTEAKELIKAIQVYYNPDQPPKPGMIEGATQKSKKMVEEIL
KYEALLLTHESSIRYLQDIYTSNKQKITNLKQKVAQLEAQCQEPCKDSVRIHDTTGKDCQ
DIANKGAKESGLYFIRPLKATQQFLVYCEIDGSGNGWTVLQKRLDGSVDFKKNWIQYKEG
FGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWSGRTSTADYAMFRVGPESDKY
RLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMHFSTWDNDNDKFEGNCAEQDGSGW
WMNKCHAGHLNGVYYQGGTYSKSSTPNGYDNGIIWATWKTRWYSMKETTMKIIPFNRLSI
GDGQQHHMGGSKQVGDM
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgaattggtccttgcaactccggagtttcattctatgctgggcgcttttactactttct
ccaacgggcctggcacagtacactgctactagagataactgttgcatcctagatgagaga
ttcggtagttactgcccaaccacttgtggcatctcagacttcctgaattcttaccaaacc
gacgtggacactgacctccagactctggaaaacatcttacaacgagctgaaaacagaacc
acagaagccaaggaactgattaaagccatccaggtttactacaacccagaccaaccccca
aagccgggtatgatagagggtgccactcagaagtctaagaagatggtagaagaaatcttg
aagtacgaagcactgttactaacccatgagtcgagtatccggtatttacaggacatctat
acttcaaataagcagaagatcacgaacctgaaacagaaggtggcccagcttgaagctcag
tgccaggagccttgcaaggactctgtgcgaatccatgacacaaccggaaaagattgtcag
gatatcgccaacaagggtgccaaagaaagtggactttacttcattcggcctttgaaagcc
acgcagcagttcttagtgtactgtgaaatcgacggatctggaaatggctggaccgtattg
cagaagaggcttgatggcagtgtggatttcaagaagaactggattcagtataaagaagga
tttggacacctgtcacctactggcaccacagagttttggctgggcaatgagaagattcat
ctgataagcatgcagtccaccatcccatacgcactgagaatacagctcaaagactggagt
ggcaggaccagcaccgcggactatgccatgttcagggtgggtcctgaatccgacaaatac
cgcctgacctatgcctacttcattggcggagatgccggggatgccttcgacggctacgat
tttggtgatgatcccagtgacaagtttttcacatcccacaacggcatgcacttcagtacc
tgggacaatgacaacgacaagttcgaaggcaactgtgctgagcaggatggatctggctgg
tggatgaacaagtgtcacgctggccacctcaatggagtttattaccaaggtggcacttac
tccaagtcatctactcctaacggttatgacaatggcattatttgggccacctggaaaacc
cgctggtattccatgaaggaaaccaccatgaagataattcccttcaacagactctccatt
ggagatgggcagcaacatcacatgggaggatccaaacaggttggagacatgtaa

KEGG   Rattus norvegicus (rat): 361969
Entry
361969            CDS       T01003                                 

Gene name
Fga
Definition
(RefSeq) fibrinogen alpha chain isoform 1 precursor
  KO
K03903  fibrinogen alpha chain
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04611  Platelet activation
rno04613  Neutrophil extracellular trap formation
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    361969 (Fga)
   04611 Platelet activation
    361969 (Fga)
   04613 Neutrophil extracellular trap formation
    361969 (Fga)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    361969 (Fga)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    361969 (Fga)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    361969 (Fga)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   361969 (Fga)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   361969 (Fga)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   361969 (Fga)
SSDB
Motif
Pfam: Fibrinogen_C Fib_alpha Fibrinogen_aC
Other DBs
NCBI-GeneID: 361969
NCBI-ProteinID: NP_001008724
RGD: 2603
Ensembl: ENSRNOG00000024848
UniProt: Q7TQ70
Position
2
AA seq 782 aa
MLSLRVACLILSLASTVWTADTGTTSEFIEAGGDIRGPRIVERQPSQCKETDWPFCSDED
WNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQKNNKDSNSLTRNIMEYLRGDFAN
ANNFDNTFGQVSEDLRRRIEILKRKVIEKAQQIQVLQKDVRDQLIDMKRLEVDIDIKIRS
CKGSCSRSVSREINLKDYEGQQKQLEQVIAKELLPAKDRQYLPAIKMSPVPDLVPGSFKS
QLQEGPPEWKALTEMRQMRMELERPGKDGASRGDLPGDSRGDSATRGPGSKIENPMTPGH
GGSGYWRPGSSGSGSDGNWGSGTTGSDDTGTWGAGSSRPSSGSGNLKPSNPDWGEFSEFG
GSSSPATRKEYHTGKLVTSKGDKELLIGNEKVTSTGTSTTRRSCSKTITKTVLGNDGHRE
VVKEVVTSDDGSDCGDGMDLGLTHSFSGRLDELSRMHPELGSFYDSRFGSLTSNFKEFGS
KTSDSDIFTDIENPSSHVPEFSSSSKTSTVRKQVTKSYKMADEAASEAHQEGDTRTTKRG
RARTMRDCDDVLQTHPSGAQNGIFSIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLN
FNRTWQDYKRGFGSLNDKGEGEFWLGNDYLHLLTLRGSVLRVELEDWAGKEAYAEYHFRV
GSEAEGYALQVSSYQGTAGDALMEGSVEEGTEYTSHSNMQFSTFDRDADQWEENCAEVYG
GGWWYNSCQAANLNGIYYPGGTYDPRNNSPYEIENGVVWVPFRGADYSLRAVRMKIRPLV
GQ
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgctttccctgagggtcgcctgcctcatcctgagcttggccagcacagtctggactgca
gacaccggcaccacaagtgaattcatagaagcaggaggagatattcgtggcccaagaatt
gtggagagacagcctagtcaatgcaaggagacagattggcccttctgctctgatgaagac
tggaaccacaaatgcccttcaggctgcaggatgaaagggttgattgatgaagccaatcag
gactttacaaacagaatcaacaagctcaaaaactcactatttgattttcaaaagaacaac
aaggattctaattcactgaccaggaatatcatggagtatttgagaggggacttcgctaac
gccaacaactttgataacactttcgggcaagtgtcagaggacctgaggcgcagaattgag
atcctaaagcgcaaagtcatagagaaagcgcaacagattcaggttctgcagaaagacgtc
cgggatcagctgatagacatgaagcgcctggaggtggacattgatatcaagatccgctct
tgcaaaggatcctgcagcaggtctgtaagccgtgagataaatctaaaggactacgaaggt
cagcaaaagcaacttgaacaggtcattgctaaagagttgcttccggcaaaagacaggcag
tacttgccagcaataaaaatgtctccagttcccgacttggttcccggaagttttaagagc
cagcttcaggaggggcccccagagtggaaggcattaacagaaatgaggcagatgagaatg
gagctggagaggcccgggaaggatggggcttcgcgaggagatttaccaggagattcgcga
ggagactctgcaacacgtggaccagggtcgaagatagaaaaccccatgacccctggacat
ggtgggtctgggtattggcgtcctgggagctccggatctggaagtgatggaaattggggc
tctgggacaacggggtctgatgacactggaacctggggtgcaggaagctccagacctagc
tcaggctctgggaaccttaagcctagcaaccctgactggggtgagttttcagagtttgga
gggagtagcagcccagcgacaagaaaagagtatcacacaggaaaactggtcacttctaaa
ggagataaagagctcctcattggaaacgagaaagttacctctactggcacaagcaccaca
cgtcgttcatgctctaaaaccattactaagactgttttgggtaatgatggtcaccgggaa
gtggtcaaagaagtggtcacttcggatgatggttctgactgcggtgatggcatggactta
ggcctgacccacagttttagtggcagacttgacgaactttcccgaatgcatcctgaactt
ggttccttttatgacagccgctttggttcactcacaagtaacttcaaagaatttggcagt
aagacctctgattctgacatcttcacagacatcgagaaccctagctcccatgtacctgag
ttttcttccagtagtaaaacctcaactgtcaggaaacaagtaaccaagagctataaaatg
gcagatgaggcagcaagtgaagctcaccaagaaggagacactcgaaccaccaagaggggc
cgagctcgcacaatgagagactgcgatgatgtccttcaaacacatccttcaggtgcccaa
aatggcattttcagtatcaagctacctggatccagtaagatattttctgtttattgcgat
caagagaccagtttgggaggatggcttttgatccagcaaagaatggatggatcactgaat
tttaaccggacctggcaagactacaagagaggtttcggcagcctgaatgacaagggggaa
ggagagttctggctaggcaatgactacctccacttactcactctgagaggctctgtcctc
agggttgaattagaggactgggctggaaaagaggcttatgcggagtaccacttccgggta
ggctctgaggcagagggctatgcactgcaggtctcctcctaccagggtaccgctggagat
gctctgatggagggctctgtggaggaggggacagaatacacttcacacagcaacatgcag
ttcagtacctttgacagagatgcagaccaatgggaagagaactgtgccgaggtctacggg
ggaggctggtggtacaatagctgtcaagccgccaatctcaatggcatttactaccctggg
ggcacctatgaccccaggaacaacagtccctatgagatagagaacggagtggtctgggtt
cccttcagaggagcggattattctctgagggccgttcggatgaaaatcagaccgctggtg
ggacagtag

DBGET integrated database retrieval system