KEGG   Rattus norvegicus (rat): 24368
Entry
24368             CDS       T01003                                 

Gene name
Fh
Definition
(RefSeq) fumarate hydratase, mitochondrial precursor
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00620  Pyruvate metabolism
rno01100  Metabolic pathways
rno01200  Carbon metabolism
rno04934  Cushing syndrome
rno05200  Pathways in cancer
rno05211  Renal cell carcinoma
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    24368 (Fh)
   00620 Pyruvate metabolism
    24368 (Fh)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    24368 (Fh)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    24368 (Fh)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    24368 (Fh)
Enzymes [BR:rno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     24368 (Fh)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-GeneID: 24368
NCBI-ProteinID: NP_058701
RGD: 2614
Ensembl: ENSRNOG00000003653
UniProt: P14408
Position
13
AA seq 507 aa
MNRAFCLLARSRRFPRVPSAGAVLSGEAATLPRCAPNVVRMASQNSFRIEYDTFGELKVP
TDKYYGAQTVRSTMNFKIGGATERMPIPVIKAFGILKRAAAEVNQEYGLDPKIASAIMKA
ADEVAEGKLNDHFPLVVWQTGSGTQTNMNVNEVISNRAIEMLGGELGSKKPVHPNDHVNK
SQSSNDTFPTAMHIAAALEVHQVLLPGLQKLHDALSAKSKEFAQVIKIGRTHTQDAVPLT
LGQEFSGYVQQVQYAMERIKAAMPRIYELAAGGTAVGTGLNTRIGFAEKVAAKVAALTGL
PFVTAPNKFEALAAHDALVELSGAMNTTACSLMKIANDIRFLGSGPRSGLGELILPENEP
GSSIMPGKVNPTQCEAMTMVAAQVMGNHVAVTVGGSNGHFELNVFKPMMIKNVLHSARLL
GDASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLK
ETAIELGYLTAEQFDEWVKPKDMLGPK
NT seq 1524 nt   +upstreamnt  +downstreamnt
atgaaccgcgcattctgtctcctcgctcgctcgcgtcgcttcccgcgggtcccctccgcc
ggtgctgtattgtcaggggaagcggccaccctcccacggtgtgctccgaacgtcgtgcga
atggcaagccaaaattccttccgtatagaatacgacacctttggtgaactgaaggtccca
accgataagtattatggtgctcagactgtaagatctacgatgaactttaagattggaggt
gcgacggagagaatgccaatcccagtcattaaagcatttggcatcttgaagcgagctgct
gctgaagtgaaccaggagtatggtctcgatcccaagattgctagtgcaataatgaaggcc
gcagatgaggtagctgaaggtaaattaaacgatcactttcctctggtggtatggcagact
gggtcaggaacccagacgaacatgaatgtaaatgaagtcattagcaacagggcaatcgaa
atgctaggaggtgaacttggcagcaagaagcccgtgcaccccaatgatcacgttaacaaa
agccagagctcgaatgacaccttccccacagcaatgcacattgctgctgcactggaagtt
caccaggtcctgttgccaggattacagaagctgcacgatgccctcagtgcaaaatccaaa
gagttcgcgcaggtcataaaaattgggcggactcatacgcaggacgctgtccctcttact
cttggacaggagttcagtggttatgttcagcaagtccagtatgcgatggagaggataaaa
gctgccatgcccagaatctacgagctcgctgctggcggcactgccgtcggcacgggacta
aacaccaggatcggcttcgcagaaaaggtggctgcaaaagtcgcagcactcacaggtttg
ccttttgtcactgccccgaataagtttgaagctctggccgctcatgatgctctggtggag
cttagtggagccatgaacactacggcctgcagtctgatgaagattgccaatgacattcgc
ttcctcggttctggtcctcggtccggtttgggggagctgatcttgcctgaaaatgagcca
gggagcagcataatgccaggaaaggtgaaccctactcagtgtgaggcgatgaccatggtt
gcagcccaagtcatggggaatcatgtcgctgttactgttggaggcagcaatggacatttc
gaactgaatgtttttaaaccgatgatgattaagaatgtgttgcactcagccaggctactg
ggagatgcttcagtgtccttcacagagaactgtgtggtagggatccaggccaacacagag
aggatcaacaagctaatgaacgagtctttaatgttggttacagctcttaatccgcatata
gggtatgacaaagcagcgaagattgccaagactgcacacaagaacggatcaaccttaaag
gaaacggctattgaacttggctatctcacagcagagcagtttgatgagtgggtgaaaccc
aaggacatgctgggtccaaagtga

DBGET integrated database retrieval system