KEGG   Rattus norvegicus (rat): 24373
Entry
24373             CDS       T01003                                 

Gene name
Fst
Definition
(RefSeq) follistatin precursor
  KO
K04661  follistatin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    24373 (Fst)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    24373 (Fst)
Peptidases and inhibitors [BR:rno01002]
 Peptidase inhibitors
  Family I1: Kazal family
   24373 (Fst)
SSDB
Motif
Pfam: Kazal_2 Kazal_1 FOLN
Other DBs
NCBI-GeneID: 24373
NCBI-ProteinID: NP_036693
RGD: 2633
Ensembl: ENSRNOG00000011631
UniProt: P21674
Structure
PDB: 
1LR7 2ARP 1LR8 1LR9

Position
2
AA seq 344 aa
MVCARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGR
LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAP
DCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCV
VDQTNNAYCVTCNRICPEPSSSEQSLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCI
KAKSCEDIQCGGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEA
ACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSTLEW
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggtctgcgccaggcaccagcccggcgggctctgcctcctgctgctgctactctgccaa
ttcatggaagaccgcagcgcccaggctgggaattgctggctccgccaagccaagaacggc
cgctgccaggtcctgtataagacagaactgagcaaggaagagtgttgcagcaccggccgg
ctgagcacctcgtggaccgaggaggatgtgaacgacaatactctcttcaagtggatgatt
ttcaacgggggcgcccccaactgcatcccttgtaaagaaacgtgtgagaatgtggactgt
ggccccgggaaaaagtgccgaatgaacaagaagaacaaaccccgctgcgtctgtgcccca
gactgttccaacatcacctggaagggtccagtgtgtgggctcgatgggaaaacctaccgc
aacgaatgtgcgctcctcaaggccagatgtaaagagcagccggaactggaagtccagtac
cagggcaaatgtaaaaagacttgcagggatgttttctgtccaggcagctccacttgtgtg
gtggatcagaccaataatgcctactgtgtgacctgtaatcggatttgcccggaaccctca
tcttcagagcagtccctttgcgggaacgatggtgtgacttactccagtgcctgccacctg
agaaaggccacctgcttgctgggcagatccattggattagcctatgagggaaagtgtatc
aaagcaaagtcttgtgaagacatccagtgcggtggtggaaaaaaatgcctatgggatttc
aaggttggcagaggtcgctgctctctctgcgatgagctgtgcccggacagtaagtcggat
gagcccgtctgtgccagcgacaatgccacgtacgccagcgagtgtgccatgaaggaagct
gcctgctcctccggcgtactgcttgaagtgaagcactccggatcttgcaactccatctcg
gaagaaacggaggaagaggaggaagaggaagaccaggactacagcttccctatctcttcc
actctagagtggtaa

DBGET integrated database retrieval system