KEGG   Rattus norvegicus (rat): 24375
Entry
24375             CDS       T01003                                 

Gene name
Fuca1
Definition
(RefSeq) tissue alpha-L-fucosidase precursor
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    24375 (Fuca1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    24375 (Fuca1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    24375 (Fuca1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     24375 (Fuca1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   24375 (Fuca1)
SSDB
Motif
Pfam: Alpha_L_fucos Fucosidase_C GHL6
Other DBs
NCBI-GeneID: 24375
NCBI-ProteinID: NP_036694
RGD: 2636
Ensembl: ENSRNOG00000009325
UniProt: P17164 A0A0G2JSJ8
Position
5
AA seq 462 aa
MWELKSEWWAVGFGLLLLLAASAQAGGLAPHHYTPDWPSLDSRPLPRWFDEAKFGLFVHW
GVYSVPAWGSEWFWWHWQGEQSSAYVRFMKENYPPGFSYADFAPQFTARFFHPEEWADLF
QAAGAKYVVLTAKHHEGFTNWPSAVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHS
LFEWFHPLYLLDKKNGLKTQHFVSTKTMPELYDLVNRYKPDLIWSDGEWECPDSYWNSTE
FLAWLYNESPVKDQVVVNDRWGQNCSCRHGGYYNCEDKYRPHSLPDHKWEMCTSVDKASW
GYRRDMSMSTIVDENEIIEELVQTISLGGNYLLNIGPNKDGVIVPIFQERLLAVGKWLQI
NGEAIYASKPWRVQSEKNKTVVWYTTKDSAVYATFLHWPEDGVVNLQSPKMTSATKITML
GMEGELHWTQDPLEGVLITLPQLPPGTFPVESAWTLKLTKVN
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtgggagctgaaaagtgagtggtgggcggtgggcttcgggcttctgctgctactggca
gcttcggcccaggcagggggcttggctccgcaccactacactccggactggccgagcttg
gactcgcgaccactgccgagatggttcgacgaggccaagttcgggttgttcgtgcattgg
ggggtgtactcggtgcccgcctggggcagcgagtggttctggtggcactggcagggcgag
cagtcgtcggcgtacgtgcgcttcatgaaagaaaactacccgcccggcttcagctacgcc
gactttgcaccgcagtttacagcgcgcttcttccatccggaggagtgggcagacctcttc
caggctgccggggccaagtatgtcgtcctgaccgcaaagcatcacgaaggcttcacaaac
tggccaagcgccgtgtcttggaactggaactcgaaggacgtggggccccaccgtgatttg
gtcggtgagttgggagcagctgtgcggaagaggaacatacgatacggcctctaccactcg
ctctttgagtggttccatccactctacctactagataagaaaaatggcctcaagactcag
catttcgtcagtacaaaaacaatgccagagctgtacgacctcgtgaataggtacaagcct
gacctaatctggtctgatggggagtgggagtgtcccgattcgtactggaactccacggag
ttccttgcttggctctacaatgaaagcccggtcaaggatcaggtggtagtgaatgaccgg
tggggtcagaactgctcctgtcgtcacggagggtactacaactgtgaagacaaatacaga
ccacacagcctgccagaccacaagtgggagatgtgcaccagcgtggacaaggcgtcctgg
ggctatcggagagacatgagcatgtctaccatcgtcgacgaaaatgaaatcattgaggaa
ttggttcagacaataagtctgggaggcaactatcttctcaacatcggaccgaataaagac
ggcgtgatcgtccccatcttccaggaaaggctccttgctgttggcaagtggctgcagatc
aacggggaggccatctatgcctccaaaccatggagggtgcagtctgaaaagaacaagaca
gttgtgtggtacaccactaaagactcggctgtttatgccacttttctgcactggccagaa
gatggagtggtaaacctccaatctcccaaaatgacatcggccacaaagataacgatgcta
ggaatggaaggagaactgcactggacccaggacccactggaaggcgtcctcatcactctg
ccccagttgccaccaggcactttcccagtggagtctgcctggactctaaagctgacaaaa
gtgaactga

KEGG   Rattus norvegicus (rat): 292485
Entry
292485            CDS       T01003                                 

Gene name
Fuca2
Definition
(RefSeq) plasma alpha-L-fucosidase precursor
  KO
K01206  alpha-L-fucosidase [EC:3.2.1.51]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00511  Other glycan degradation
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    292485 (Fuca2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    292485 (Fuca2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    292485 (Fuca2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.51  alpha-L-fucosidase
     292485 (Fuca2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   292485 (Fuca2)
SSDB
Motif
Pfam: Alpha_L_fucos Fucosidase_C
Other DBs
NCBI-GeneID: 292485
NCBI-ProteinID: NP_001004218
RGD: 1303053
Ensembl: ENSRNOG00000015551
UniProt: Q6AYS4
Position
1
AA seq 459 aa
MRLGLLMFLPLLLLATRYRAVTALSYDPTWESLDRRPLPAWFDQAKFGIFIHWGVFSVPS
FGSEWFWWYWQKERRPKFVDFMDNNYPPGFKYEDFGVLFTAKYFNANQWADLLQASGAKY
VVLTSKHHEGFTLWGSAHSWNWNAVDEGPKRDIVKELEVAVRNRTDLHFGLYYSLFEWFH
PLFLEDQSSAFQKQRFPVAKTLPELYELVTKYQPEVLWSDGDGGAPDHYWNSTDFLAWLY
NESPVRDTVVTNDRWGAGSICKHGGYYTCSDRYNPGHLLPHKWENCMTIDKFSWGYRREA
EIGDYLTIEELVKQLVETVSCGGNLLMNIGPTLDGIIPVIFEERLRQMGTWLKVNGEAIY
ETHTWRSQNDTVTPDVWYTSKPEKKLVYAIFLKWPISGKLFLGQPIGSLGETEVELLGHG
RPLTWTSSKPSGIVVELPRLSVHQMPCKWGWTLALTNVT
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcgcctggggctcctgatgtttctgccgctactgctgctggcaacccggtaccgggcc
gtgacagcccttagctatgaccccacgtgggagtctctggacagacgcccgctgccagcc
tggttcgaccaggccaagttcggcatcttcatccactggggagtgttttccgtgcccagc
tttggtagtgaatggttctggtggtattggcaaaaggaaaggagacccaagtttgtggac
tttatggacaataattatccccctggctttaagtatgaagattttggagtgttatttaca
gccaagtattttaacgcaaaccaatgggcagatcttctccaggcctctggtgccaaatat
gtggtcttaacttccaaacatcatgaaggattcactctgtggggttcggcccattcttgg
aattggaacgcggtcgatgaggggccgaagagggacatcgtcaaggagcttgaggtggct
gtgaggaacaggactgacttgcactttggtctgtactattctctttttgaatggttccac
ccactctttctggaggatcaatccagcgcgttccagaagcagcggtttcccgttgctaag
acgttgcctgagctctatgagttggtgaccaagtaccagccggaagttctgtggtcagac
ggagatgggggagcgccagatcactactggaatagtactgacttcttggcctggctctat
aacgaaagcccagttcgggacacagtagtcaccaatgatcgctggggagctggctctatc
tgcaaacacggtggttactatacttgcagtgaccgttataatcccggacatctcttgcca
cacaagtgggagaactgcatgacaatagacaagttctcctggggctacagacgggaggct
gaaatcggtgactatcttaccattgaagaattggtgaagcaacttgtggaaacggtctca
tgtggaggaaatctcctgatgaatattggccccacactagatggcatcattcctgtaatt
tttgaggagcgcttaaggcaaatgggaacctggctgaaagtcaacggggaagctatttat
gaaacacatacttggaggtctcagaacgacaccgtcactcctgacgtgtggtacacatct
aaacctgagaagaaattagtctatgctatttttctgaaatggcccatctctggaaagctg
tttcttggacaacccataggtagtctgggggaaacagaggtagaactactgggccacgga
cggccactgacttggacatcttcaaagccaagcggcattgtggtggagttgccccggcta
agcgttcatcagatgccctgtaaatggggatggactctggcactaaccaatgtcacttaa

DBGET integrated database retrieval system